BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e05 (519 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1279 + 27510605-27513301 31 0.42 03_05_0060 + 20363857-20365359 29 1.7 12_02_1074 - 25849280-25849324,25849435-25849506,25849601-258496... 27 9.0 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 27 9.0 02_05_0707 + 31096628-31096630,31097037-31097405,31097477-31101715 27 9.0 >12_02_1279 + 27510605-27513301 Length = 898 Score = 31.5 bits (68), Expect = 0.42 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 46 LQTVMSAIRGGCSGCPSPCNSTRNCTPCCSGGS 144 L TV +A GGC P PC S CTP +G S Sbjct: 298 LPTVWAAPTGGCD-LPLPCRSLGLCTPGTNGSS 329 >03_05_0060 + 20363857-20365359 Length = 500 Score = 29.5 bits (63), Expect = 1.7 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 146 RDPPLQH--GVQFLVELQGDGHPLQPPRIADITVCNLLIA 33 R PPL GV L L GHPL R+A + + NL +A Sbjct: 36 RRPPLDTAVGVTVLQHLMEAGHPLNSTRVARLGLRNLAVA 75 >12_02_1074 - 25849280-25849324,25849435-25849506,25849601-25849663, 25849756-25849865,25850648-25850761,25851601-25851681, 25851736-25851850 Length = 199 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%) Frame = +1 Query: 79 CSGCPSPCNSTRNCTP----CCSGGSLVTVYSQVAHI 177 C GC + TRN T CC +LV S +AH+ Sbjct: 74 CGGCRTLLMYTRNATSVRCSCCDTVNLVRPVSSIAHL 110 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 27.1 bits (57), Expect = 9.0 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -1 Query: 213 LTQHLMVSGKSLDMCYLTVNCDQRSSAAARSTISGGV 103 ++ HL SGKS V DQ S+ AA S +G + Sbjct: 96 VSSHLRTSGKSSQAYAFAVFADQPSALAAMSATNGRI 132 >02_05_0707 + 31096628-31096630,31097037-31097405,31097477-31101715 Length = 1536 Score = 27.1 bits (57), Expect = 9.0 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = +2 Query: 5 INLKCVIAWMLLINYKLLCPQFEAVAADAHRPVTPPEIVLRAAAEDLW 148 INL C+ ++ ++ L P VAA A P PPE +LR E W Sbjct: 1088 INLPCLSPFISPMSSGLPAPI--KVAATAKGPFVPPENLLRFQPETGW 1133 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,984,317 Number of Sequences: 37544 Number of extensions: 284860 Number of successful extensions: 944 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 943 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1130733700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -