BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e05 (519 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. 24 2.7 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 24 3.5 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 4.7 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 6.2 >DQ182017-1|ABA56309.1| 383|Anopheles gambiae G(alpha)s protein. Length = 383 Score = 24.2 bits (50), Expect = 2.7 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = +3 Query: 66 NSRRLQRMPIAL*LHQKLYSVLQRRISGHSLQSSSTYPMI--FQTP*DAVLAIGQPPRPI 239 N+R L+ + + L L+++ +L +I + S + +QTP DAV +G+ P I Sbjct: 267 NNRWLRTISVILFLNKQ--DLLAEKIKAGKSKLSDYFGEFNRYQTPADAVCEMGEDPEVI 324 Query: 240 AA 245 A Sbjct: 325 RA 326 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 23.8 bits (49), Expect = 3.5 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +3 Query: 177 PMIFQTP*DAVLAIGQPPRPIAA 245 P+ +Q V IG PPRP+ A Sbjct: 155 PLTYQMFLHTVNIIGDPPRPVGA 177 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 161 VK*HISNDFPDTIRCCV 211 +K I N F TIRCCV Sbjct: 376 IKALIGNLFAQTIRCCV 392 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.0 bits (47), Expect = 6.2 Identities = 8/12 (66%), Positives = 11/12 (91%) Frame = +3 Query: 162 SSSTYPMIFQTP 197 S++TYP IF+TP Sbjct: 1114 SATTYPSIFKTP 1125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,239 Number of Sequences: 2352 Number of extensions: 11035 Number of successful extensions: 22 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -