BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e05 (519 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g09570.1 68417.m01575 calcium-dependent protein kinase, putat... 27 5.7 At2g39240.1 68415.m04819 RNA polymerase I specific transcription... 27 5.7 At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDP... 27 7.6 >At4g09570.1 68417.m01575 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 501 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +2 Query: 56 LCPQFEAVAADAHRPVTPPEIVLRAAAEDLWSQFTVK*HISNDFPDTIRCCVSY 217 LC + + A A + + ++V R ED+W + + H+S + P+ +R +Y Sbjct: 41 LCTEKSSSANYACKSIPKRKLVCREDYEDVWREIQIMHHLS-EHPNVVRIKGTY 93 >At2g39240.1 68415.m04819 RNA polymerase I specific transcription initiation factor RRN3 family protein contains Pfam profile PF05327: RNA polymerase I specific transcription initiation factor RRN3 Length = 545 Score = 27.5 bits (58), Expect = 5.7 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -3 Query: 430 LQILTRYNTQIHKIILLLPLTQNIFL 353 L++L+R + +HKI L+PL +I L Sbjct: 149 LEVLSRVHAALHKISYLVPLAPSILL 174 >At1g35670.1 68414.m04435 calcium-dependent protein kinase 2 (CDPK2) identical to calcium-dependent protein kinase [Arabidopsis thaliana] gi|604881|dbj|BAA04830; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 495 Score = 27.1 bits (57), Expect = 7.6 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = +2 Query: 56 LCPQFEAVAADAHRPVTPPEIVLRAAAEDLWSQFTVK*HISNDFPDTIRCCVSY 217 LC + A A + + ++V R ED+W + + H+S + P+ +R +Y Sbjct: 42 LCTEKSTSANYACKSIPKRKLVCREDYEDVWREIQIMHHLS-EHPNVVRIKGTY 94 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,083,343 Number of Sequences: 28952 Number of extensions: 219726 Number of successful extensions: 561 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -