BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e02 (437 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7976| Best HMM Match : ShTK (HMM E-Value=0.001) 32 0.18 SB_39963| Best HMM Match : EGF (HMM E-Value=1.4e-13) 30 0.73 SB_47044| Best HMM Match : UPF0153 (HMM E-Value=2.9e-07) 28 2.9 SB_12889| Best HMM Match : Peptidase_S9 (HMM E-Value=1.4e-38) 28 3.9 SB_8176| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 27 5.1 SB_19900| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.1 SB_38005| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.9 SB_22263| Best HMM Match : LicD (HMM E-Value=5e-06) 27 8.9 >SB_7976| Best HMM Match : ShTK (HMM E-Value=0.001) Length = 277 Score = 32.3 bits (70), Expect = 0.18 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = -2 Query: 346 VDRVGLVARNLSTNFPCISSCRMRKQTKQRQSPEP 242 V R GL + +F CIS+C K KQR+ PEP Sbjct: 101 VSRKGLKTKAARVSFDCISNC-SEKAIKQRRLPEP 134 >SB_39963| Best HMM Match : EGF (HMM E-Value=1.4e-13) Length = 3035 Score = 30.3 bits (65), Expect = 0.73 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 37 YYKFPKMLRATILRAKKTFTANTLR--VKICLNKRQYSSKPDRCDAHMNELPVPCG 198 Y + P + T + K+ + N R K+CL+ Y KP RC+ H ++ + CG Sbjct: 634 YERTPVLALHTKIARAKSKSENWCRDYEKLCLS---YGRKPARCEMHTKDVQLKCG 686 >SB_47044| Best HMM Match : UPF0153 (HMM E-Value=2.9e-07) Length = 237 Score = 28.3 bits (60), Expect = 2.9 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = -3 Query: 384 WFNILTFFNHVAWWTGLGWWR 322 W + T NH WT WWR Sbjct: 76 WLLLATTLNHCLAWTAQPWWR 96 >SB_12889| Best HMM Match : Peptidase_S9 (HMM E-Value=1.4e-38) Length = 253 Score = 27.9 bits (59), Expect = 3.9 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = -2 Query: 307 NFPCISSCRMRKQTKQRQSPEPCYNSFACLCTTAPMVHTVLEAHSYGRH 161 +F I+ + ++ Q P PCY C +V T L A YG H Sbjct: 194 SFKFIAELQHVMGSQDNQCPIPCYGHAQCRYFVRVLVITRLHAMLYGAH 242 >SB_8176| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 364 Score = 27.5 bits (58), Expect = 5.1 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -1 Query: 137 CLLFKHILTLNVFAVKVFFALKIVALSILGNL*YLLTSFF 18 C+L +LTL F + F+ LK + +L N+ Y + +FF Sbjct: 221 CMLAALLLTLCWFPTETFWILKQYKVVVLPNVWYWVFNFF 260 >SB_19900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 27.5 bits (58), Expect = 5.1 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = -1 Query: 137 CLLFKHILTLNVFAVKVFFALKIVALSILGNL*YLLTSFF 18 C+L +LTL F + F+ LK + +L N+ Y + +FF Sbjct: 221 CMLAALLLTLCWFPTETFWILKQYKVVVLPNVWYWVFNFF 260 >SB_38005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 26.6 bits (56), Expect = 8.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 338 GWAGGEKFKYKLSVYIIMPNEKANQATPITR 246 G+ KY+L YI+ PN+ N+ TP+ R Sbjct: 59 GYPESHNNKYELQSYIL-PNQPINEKTPLHR 88 >SB_22263| Best HMM Match : LicD (HMM E-Value=5e-06) Length = 374 Score = 26.6 bits (56), Expect = 8.9 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 187 VPCGPWEPWYKDMQSYYNKVLVIGVAWFAFSFGMMI 294 VP PW P +D QS Y L A+ G+M+ Sbjct: 241 VPGAPWNPRLRDTQSCYKWCLTFQHKQCAWHDGLML 276 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,313,971 Number of Sequences: 59808 Number of extensions: 265839 Number of successful extensions: 724 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 847047381 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -