BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e02 (437 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 4.8 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 22 8.3 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 22 8.3 AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase pr... 22 8.3 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 4.8 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 330 WWREI*VQTFRVYHHAE*ESKPSN 259 W E V F +HH+ ++KP N Sbjct: 465 WGHEQGVSLFASHHHSTGDNKPPN 488 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.2 bits (45), Expect = 8.3 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -2 Query: 217 CTTAPMVHTVLEAHSYGRHIDQALTNIVSY 128 C T + HTVL ++Y + D+ + ++ Y Sbjct: 952 CYTTVIPHTVLTQYNYTVNTDEKDSFVLGY 981 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 22.2 bits (45), Expect = 8.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 271 QTKQRQSPEPCYNSFACLCTTAPMVHTVLEAHS 173 +T Q+ S C NS C+ A + HT+ + S Sbjct: 50 ETNQKSST--CTNSKECIAGIARVYHTIKQLKS 80 >AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase protein. Length = 98 Score = 22.2 bits (45), Expect = 8.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 271 QTKQRQSPEPCYNSFACLCTTAPMVHTVLEAHS 173 +T Q+ S C NS C+ A + HT+ + S Sbjct: 50 ETNQKSST--CTNSKECIAGIARVYHTIKQLKS 80 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 464,178 Number of Sequences: 2352 Number of extensions: 10085 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36568146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -