BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e01 (676 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 4.0 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 4.0 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 22.2 bits (45), Expect = 4.0 Identities = 11/37 (29%), Positives = 14/37 (37%) Frame = -3 Query: 254 PVVSGTGSFGPRQPNDRIMCLQSLHSAALRSFSLIPN 144 P S G F P+ PN + H + L PN Sbjct: 30 PDASTLGQFSPQGPNSPVSFSMGGHGSLLSPSGNTPN 66 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -1 Query: 595 YGLFNGQHV*SYVNRVAF 542 +G F G H+ SY+N+ +F Sbjct: 374 FGFF-GTHILSYINKASF 390 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,421 Number of Sequences: 336 Number of extensions: 3675 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -