BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d22 (675 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF000265-10|AAB52949.2| 335|Caenorhabditis elegans Hypothetical... 32 0.32 Z46266-9|CAO78710.1| 790|Caenorhabditis elegans Hypothetical pr... 28 7.0 AF016452-1|AAB66013.1| 511|Caenorhabditis elegans Hypothetical ... 27 9.2 >AF000265-10|AAB52949.2| 335|Caenorhabditis elegans Hypothetical protein C18E3.1 protein. Length = 335 Score = 32.3 bits (70), Expect = 0.32 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 245 VHLWRFHYNKLPRQDLCLYDHKVSDPLF 162 +HL R K QDLC +D K+ +PLF Sbjct: 63 IHLDRSKMRKAVHQDLCTHDQKILEPLF 90 >Z46266-9|CAO78710.1| 790|Caenorhabditis elegans Hypothetical protein ZK899.8j protein. Length = 790 Score = 27.9 bits (59), Expect = 7.0 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -1 Query: 465 IRIASLFSSNCSLTL*VKHSDPRPDTATNANVGSKSKNILDSPNFGMGDNFNIFQSLP 292 +R++SLF C T+ HSD +A +G KS + +SP+ + + LP Sbjct: 61 VRVSSLFGEYCRYTVNTSHSDSGTSRIASA-LGGKSSS-QESPSLRIKARWQSVHILP 116 >AF016452-1|AAB66013.1| 511|Caenorhabditis elegans Hypothetical protein T05H4.7 protein. Length = 511 Score = 27.5 bits (58), Expect = 9.2 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +2 Query: 95 HVRYISQFKIQRTDCVP--YGTPRKIKDPKLCGHK 193 H + + +K Q DC P YG P DPKL H+ Sbjct: 429 HPDWGNMWKSQSCDCAPAPYGGPLPYYDPKLYPHE 463 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,414,094 Number of Sequences: 27780 Number of extensions: 371633 Number of successful extensions: 906 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 906 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -