BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d19 (357 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45611| Best HMM Match : p450 (HMM E-Value=0) 29 1.5 SB_9053| Best HMM Match : TIG (HMM E-Value=0) 27 3.4 SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.4 SB_8290| Best HMM Match : WD40 (HMM E-Value=2) 27 3.4 SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 26 7.8 SB_31777| Best HMM Match : Homeobox (HMM E-Value=1.3) 26 7.8 SB_20038| Best HMM Match : wnt (HMM E-Value=3.8e-05) 26 7.8 SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.8 >SB_45611| Best HMM Match : p450 (HMM E-Value=0) Length = 847 Score = 28.7 bits (61), Expect = 1.5 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = -1 Query: 267 LILTNTQAGMADQPTTIRPARK-IISPLETLFLGGVQITLMFLCWA 133 L+L +AG+ + K I+S + T+F+ G + T LCWA Sbjct: 614 LLLAKQEAGVENTTDQKYLEDKYIVSAISTVFIAGSETTATSLCWA 659 >SB_9053| Best HMM Match : TIG (HMM E-Value=0) Length = 2990 Score = 27.5 bits (58), Expect = 3.4 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = -1 Query: 267 LILTNTQAGMADQPTTIRPARKIIS--PLETLFLGGVQITLM 148 L + N DQ T++ + IIS P ET GGV+ITL+ Sbjct: 1415 LYVNNKGFARFDQATSVTSSANIISVTPTETGINGGVRITLV 1456 >SB_20002| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2484 Score = 27.5 bits (58), Expect = 3.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 301 FVIILLLVAVMLDIDQHPGWDG 236 FV LL + +DI+ HPGW G Sbjct: 738 FVEFLLSLGWPVDIETHPGWTG 759 >SB_8290| Best HMM Match : WD40 (HMM E-Value=2) Length = 233 Score = 27.5 bits (58), Expect = 3.4 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +2 Query: 152 SVICTPPRNKVSRGEMIFLAGLMVV-GWSAIPAWVLVNIKH 271 +V P K R E F L+V GWSA+ AWV ++ H Sbjct: 79 AVTANLPYPKTIRPE--FRVSLLVTSGWSAVTAWVKSSVTH 117 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 26.2 bits (55), Expect = 7.8 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +2 Query: 122 FKNVAQQRNMSVICTPPRNKVSRGEMIFLAGL 217 + V + R MS++ P ++ RG + AGL Sbjct: 338 YSTVTRGRRMSIVVQPSTRRMRRGSSVAAAGL 369 >SB_31777| Best HMM Match : Homeobox (HMM E-Value=1.3) Length = 420 Score = 26.2 bits (55), Expect = 7.8 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 173 RNKVSRGEMIFLAGLMVVGWSAIPAWVLVNIKH 271 RNK +GE+ L+V WS +P N KH Sbjct: 213 RNKKRQGEICNACVLLVKRWSKLPPGTEKNWKH 245 >SB_20038| Best HMM Match : wnt (HMM E-Value=3.8e-05) Length = 155 Score = 26.2 bits (55), Expect = 7.8 Identities = 15/54 (27%), Positives = 22/54 (40%) Frame = +1 Query: 118 NL*ECRPTKEHERYLHSAKKQGFQR*DDLPRRPDGGGLVCHPSLGVGQYQALPR 279 +L EC+ ++E++ S + R LPR CHP G L R Sbjct: 42 SLKECKSQFQNEKWNCSVRFASSNRMPGLPRLAPSAAHYCHPDASKGSTGVLGR 95 >SB_52216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 979 Score = 26.2 bits (55), Expect = 7.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 190 SGNLVSWRSADNAHVPLLGDIL 125 SGNLVSWR N+ P GD++ Sbjct: 598 SGNLVSWRDLRNS--PRYGDVV 617 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,351,344 Number of Sequences: 59808 Number of extensions: 199640 Number of successful extensions: 899 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 899 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 560496285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -