BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d19 (357 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006662-3|AAF39895.1| 368|Caenorhabditis elegans Hypothetical ... 32 0.14 U41538-5|AAG00012.2| 762|Caenorhabditis elegans Hypothetical pr... 30 0.41 Z49907-1|CAA90090.1| 417|Caenorhabditis elegans Hypothetical pr... 29 0.95 Z99282-1|CAB16532.1| 1037|Caenorhabditis elegans Hypothetical pr... 28 1.7 AF098997-10|AAC68712.2| 325|Caenorhabditis elegans Serpentine r... 27 2.9 AF067211-8|ABB51202.1| 99|Caenorhabditis elegans Hypothetical ... 27 5.1 Z83731-6|CAN86605.2| 208|Caenorhabditis elegans Hypothetical pr... 26 6.7 Z83731-5|CAN86604.2| 223|Caenorhabditis elegans Hypothetical pr... 26 6.7 Z81053-4|CAB02879.1| 418|Caenorhabditis elegans Hypothetical pr... 26 6.7 Z78063-7|CAB01506.1| 418|Caenorhabditis elegans Hypothetical pr... 26 6.7 U61947-10|AAB03132.1| 932|Caenorhabditis elegans Kinesin-like p... 26 6.7 AY211948-1|AAO34669.1| 932|Caenorhabditis elegans kinesin-like ... 26 6.7 AL032647-1|CAA21688.2| 470|Caenorhabditis elegans Hypothetical ... 26 6.7 AB033538-1|BAB19356.2| 930|Caenorhabditis elegans kinesin like ... 26 6.7 AF098997-9|AAC68720.1| 325|Caenorhabditis elegans Serpentine re... 26 8.9 >AC006662-3|AAF39895.1| 368|Caenorhabditis elegans Hypothetical protein H23L24.4 protein. Length = 368 Score = 31.9 bits (69), Expect = 0.14 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -1 Query: 120 IWLLARSKFLIPNILF*YNYSSKCSLKFFYVKLTM 16 +W SK+L+PN +F Y SS C+ + +V L + Sbjct: 35 LWDRTYSKYLLPNSIFLYKRSSTCTRTYIFVILRL 69 >U41538-5|AAG00012.2| 762|Caenorhabditis elegans Hypothetical protein R04E5.2 protein. Length = 762 Score = 30.3 bits (65), Expect = 0.41 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 110 NNQIFKNVAQQRNMSVICTPPRNKVSRGEM-IFLAGLM 220 N + F+N+ Q+ V+ PP+N S G + +F AG+M Sbjct: 572 NPKAFENLIQRNIREVLIVPPKNSTSPGTLNLFEAGVM 609 >Z49907-1|CAA90090.1| 417|Caenorhabditis elegans Hypothetical protein B0491.1 protein. Length = 417 Score = 29.1 bits (62), Expect = 0.95 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 246 PGCWSISSIT-ATSNKIITKKYVVYYVL 326 P CW I++ T NK+ T +Y V+Y++ Sbjct: 311 PFCWFITTFAFVTYNKVCTSQYFVWYIV 338 >Z99282-1|CAB16532.1| 1037|Caenorhabditis elegans Hypothetical protein Y70C5A.2 protein. Length = 1037 Score = 28.3 bits (60), Expect = 1.7 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 180 LFLGGVQITLMFLCWATFLKIWLLA 106 LFL G+Q+TL+F C+ FL I LA Sbjct: 214 LFLLGIQVTLLF-CFLLFLPICFLA 237 >AF098997-10|AAC68712.2| 325|Caenorhabditis elegans Serpentine receptor, class i protein43 protein. Length = 325 Score = 27.5 bits (58), Expect = 2.9 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -1 Query: 189 LETLFLGGVQITLMFLCWATFLKIWLLARSKFLIPNILF 73 + T L G+Q L+FLC+A + + +IP ILF Sbjct: 91 ITTHLLLGIQYVLLFLCFARRHQAIAKIKQHHVIPEILF 129 >AF067211-8|ABB51202.1| 99|Caenorhabditis elegans Hypothetical protein B0205.13 protein. Length = 99 Score = 26.6 bits (56), Expect = 5.1 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -3 Query: 253 HPGWDGRPAHHHQAGEEDHLTSGNLVSWRSADNAHVP 143 HP W+ HHHQ + H + N V+ ++A + +P Sbjct: 54 HPWWN----HHHQCWHQYHHRTENTVNSQNAPSQVIP 86 >Z83731-6|CAN86605.2| 208|Caenorhabditis elegans Hypothetical protein M04C9.1b protein. Length = 208 Score = 26.2 bits (55), Expect = 6.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 223 HHQAGEEDHLTSGNLVSWRSADN 155 +HQ E+ +L GN VS S DN Sbjct: 100 YHQKDEKGYLPEGNKVSCESVDN 122 >Z83731-5|CAN86604.2| 223|Caenorhabditis elegans Hypothetical protein M04C9.1a protein. Length = 223 Score = 26.2 bits (55), Expect = 6.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 223 HHQAGEEDHLTSGNLVSWRSADN 155 +HQ E+ +L GN VS S DN Sbjct: 115 YHQKDEKGYLPEGNKVSCESVDN 137 >Z81053-4|CAB02879.1| 418|Caenorhabditis elegans Hypothetical protein E02A10.1 protein. Length = 418 Score = 26.2 bits (55), Expect = 6.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 208 RRPDGGGLVCHPSL 249 RRP G GL CHP L Sbjct: 225 RRPRGFGLTCHPRL 238 >Z78063-7|CAB01506.1| 418|Caenorhabditis elegans Hypothetical protein E02A10.1 protein. Length = 418 Score = 26.2 bits (55), Expect = 6.7 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +1 Query: 208 RRPDGGGLVCHPSL 249 RRP G GL CHP L Sbjct: 225 RRPRGFGLTCHPRL 238 >U61947-10|AAB03132.1| 932|Caenorhabditis elegans Kinesin-like protein protein 18 protein. Length = 932 Score = 26.2 bits (55), Expect = 6.7 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = -1 Query: 219 IRPARKIISPLETLFLGGVQITL 151 +RP+ ++ +P E+LF+GG +T+ Sbjct: 11 VRPSARLGAPSESLFVGGRVVTI 33 >AY211948-1|AAO34669.1| 932|Caenorhabditis elegans kinesin-like protein-18 protein. Length = 932 Score = 26.2 bits (55), Expect = 6.7 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = -1 Query: 219 IRPARKIISPLETLFLGGVQITL 151 +RP+ ++ +P E+LF+GG +T+ Sbjct: 11 VRPSARLGAPSESLFVGGRVVTI 33 >AL032647-1|CAA21688.2| 470|Caenorhabditis elegans Hypothetical protein Y57A10B.1 protein. Length = 470 Score = 26.2 bits (55), Expect = 6.7 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +2 Query: 212 GLMVVGWSAIPAWVLVNIKHYRDKQ*NYHKKICSLLRSK*NVNLNQKK 355 G + + WS+ W + KH RD Q Y K+ L R +N QKK Sbjct: 412 GYLTLCWSSNLEWSIEEYKHSRDTQ--YLNKLEELRR---KINEKQKK 454 >AB033538-1|BAB19356.2| 930|Caenorhabditis elegans kinesin like protein KLP-18 protein. Length = 930 Score = 26.2 bits (55), Expect = 6.7 Identities = 9/23 (39%), Positives = 18/23 (78%) Frame = -1 Query: 219 IRPARKIISPLETLFLGGVQITL 151 +RP+ ++ +P E+LF+GG +T+ Sbjct: 9 VRPSARLGAPSESLFVGGRVVTI 31 >AF098997-9|AAC68720.1| 325|Caenorhabditis elegans Serpentine receptor, class i protein42 protein. Length = 325 Score = 25.8 bits (54), Expect = 8.9 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 168 GVQITLMFLCWATFLKIWLLARSKFLIPNIL 76 GVQ L+FLC+A + + + +IPN L Sbjct: 98 GVQYVLLFLCFARRHQAIAKIKQQHVIPNFL 128 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,982,839 Number of Sequences: 27780 Number of extensions: 156936 Number of successful extensions: 380 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 366 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 380 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 482051610 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -