BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d19 (357 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 0.82 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 1.4 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 1.9 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 5.8 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.4 bits (48), Expect = 0.82 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +1 Query: 232 VCHPSLGVGQYQALPRQAIKLSQKNM 309 +C P L + A +QA+++S N+ Sbjct: 429 ICKPKLKIADLSAHDKQAVRMSALNV 454 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.6 bits (46), Expect = 1.4 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 210 ARKIISPLETLFLGGVQITLMFLCWATF 127 +R+I S + + + L F+CWA F Sbjct: 259 SRQIQSRKSVIKMLSAVVILFFICWAPF 286 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 205 PRRPDGGGLVCHPSLGVGQYQALPRQAIKLSQKN 306 PRR + L C P L GQ Q+ P+ + + N Sbjct: 341 PRRKNNCPLHCKPEL--GQSQSSPKFVARREESN 372 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 20.6 bits (41), Expect = 5.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 159 ITLMFLCWATFLKIWLLA 106 + F+CWA F LLA Sbjct: 291 VVAFFICWAPFHAQRLLA 308 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,301 Number of Sequences: 438 Number of extensions: 2038 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8308335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -