BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d16 (633 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. 40 7e-05 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 27 0.65 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 26 0.86 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 26 0.86 Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. 25 2.0 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.0 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.0 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 3.5 DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domai... 24 4.6 AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F rec... 23 6.1 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 23 6.1 CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/c... 23 8.1 AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility pro... 23 8.1 AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility pro... 23 8.1 AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility pro... 23 8.1 AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility pro... 23 8.1 AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility pro... 23 8.1 AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility pro... 23 8.1 AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility pro... 23 8.1 AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility pro... 23 8.1 >AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. Length = 187 Score = 39.9 bits (89), Expect = 7e-05 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 429 CATNNGGCEQRCVNDPGSFHCECSPPLSLASDGKKC 536 CA NGGC C+ +P S+ C C + L +GK C Sbjct: 4 CAHKNGGCSYICLLNPTSYSCACPIGIQLKDNGKTC 39 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 26.6 bits (56), Expect = 0.65 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +3 Query: 417 DVDECATNNGGC---EQRCVNDPGSFHCECSPPLSLASDGKKCVPRIPLAI 560 D +CA NN C C SF +C P + AS+G VP P+ I Sbjct: 24 DKKQCAKNNEYCLTHRDCCSGSCLSFSYKCVPVPASASEGFISVPVKPVPI 74 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 26.2 bits (55), Expect = 0.86 Identities = 26/106 (24%), Positives = 37/106 (34%), Gaps = 5/106 (4%) Frame = +3 Query: 267 RCIPKSMEPCSLNLCEQACEVQGESMWCSCYPGFQFNAESYSKQEQPYCVDVDECATNNG 446 RC + C ++AC + SC PG + + CV VD T Sbjct: 25 RCPKNEVYSCCAPCPQKACISEAVKCQTSCLPGCVCKKGFVRETQFGNCVPVD---TTYN 81 Query: 447 GCEQRCVNDPGSFHCECSPPLSLASDGKKCV-----PRIPLAIAEP 569 +C S C C ++ KC+ PRI +A A P Sbjct: 82 PTTTKCAAGFTS-GCVCKKGFVRKTEFGKCIPLRLCPRISIASAHP 126 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 26.2 bits (55), Expect = 0.86 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 150 CCYLLRRWCQ*GAVPPLCIRC 88 CC +LR +C A PPL C Sbjct: 74 CCEILRLYCDTSACPPLIEFC 94 >Z22930-3|CAA80515.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 257 VLVCIAAVQPHALYVGVPHATRLPRPQHQVS 165 V+ C A H V P LPRP H VS Sbjct: 15 VVACAQAHASHQRRVPYPLPRFLPRPHHTVS 45 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/21 (47%), Positives = 17/21 (80%), Gaps = 2/21 (9%) Frame = +3 Query: 78 YHDDSGY--RAEEPHLTDTID 134 ++++ GY R E+P+LT+TID Sbjct: 2096 HYNEPGYLTRIEDPYLTETID 2116 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 25.0 bits (52), Expect = 2.0 Identities = 10/21 (47%), Positives = 17/21 (80%), Gaps = 2/21 (9%) Frame = +3 Query: 78 YHDDSGY--RAEEPHLTDTID 134 ++++ GY R E+P+LT+TID Sbjct: 2097 HYNEPGYLTRIEDPYLTETID 2117 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/19 (42%), Positives = 9/19 (47%) Frame = -3 Query: 334 PCTSHACSHRFRLHGSIDF 278 PC H L GS+DF Sbjct: 516 PCVDEVLKHELSLEGSLDF 534 >DQ370042-1|ABD18603.1| 194|Anopheles gambiae putative TIL domain polypeptide protein. Length = 194 Score = 23.8 bits (49), Expect = 4.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 489 CECSPPLSLASDGKKCVP 542 C C P +SDG C+P Sbjct: 172 CFCKPSYIRSSDGGPCIP 189 >AY579078-1|AAT81602.1| 425|Anopheles gambiae neuropeptide F receptor protein. Length = 425 Score = 23.4 bits (48), Expect = 6.1 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +1 Query: 439 TMVGVSNAASMILEASTANAHRRSH*LVMARNVSHGYRWLLQNLFHLCA 585 T G A + E +R++ L+++ + G WL NLF+L A Sbjct: 248 TASGKPGEAKPVRERERGRRMQRTNYLLISIALIFGVSWLPLNLFNLFA 296 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 23.4 bits (48), Expect = 6.1 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 462 SVAHTHHCSSHTRLHQHN 409 S+ H+HH H H H+ Sbjct: 493 SLTHSHHAHPHHHHHHHH 510 >CR954256-9|CAJ14150.1| 872|Anopheles gambiae putative calcium/calmodulin-dependentprotein kinase, CAKI protein. Length = 872 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -2 Query: 245 IAAVQPHALYVGVPHATRLPRPQHQ 171 + A P +PH TR PRP + Sbjct: 712 LIAKYPDKYAYPIPHTTRPPRPDEE 736 >AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 11 QRCAVRNPTKHVLLYPGFQF 30 >AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 11 QRCAVRNPTKHVLLYPGFQF 30 >AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 13 QRCAVRNPTKHVLLYPGFQF 32 >AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 13 QRCAVRNPTKHVLLYPGFQF 32 >AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 >AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 23.0 bits (47), Expect = 8.1 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 315 QACEVQGESMWCSCYPGFQF 374 Q C V+ + YPGFQF Sbjct: 14 QRCAVRNPTKHVLLYPGFQF 33 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 776,227 Number of Sequences: 2352 Number of extensions: 18371 Number of successful extensions: 129 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 127 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -