BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d15 (712 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6738| Best HMM Match : DUF1328 (HMM E-Value=2.4) 28 8.6 SB_30297| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_19016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_6738| Best HMM Match : DUF1328 (HMM E-Value=2.4) Length = 391 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 563 QWINLYSENVTLSLYF*SWLRFERFIRLRIP 471 QWI+L N+ + +YF WL F+ F + IP Sbjct: 130 QWISL---NIQIVVYFAVWLTFQLFDAILIP 157 >SB_30297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 385 Score = 27.9 bits (59), Expect = 8.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 261 PGLPVPAKMGWLWNAAD 311 P LP P K GW WN D Sbjct: 273 PVLPSPEKYGWKWNDGD 289 >SB_19016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -3 Query: 113 KLPIGPWSGPTQQF*LLYTLKFYFVTRYIV 24 K I W PT + L+YT+ F F+ +YI+ Sbjct: 115 KFCIEDWPAPTATYRLIYTV-FIFIAQYII 143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,037,123 Number of Sequences: 59808 Number of extensions: 348418 Number of successful extensions: 962 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -