BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d13 (615 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein... 24 3.4 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 7.8 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 7.8 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 7.8 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 7.8 >X87410-1|CAA60857.1| 498|Anopheles gambiae maltase-like protein Agm1 protein. Length = 498 Score = 24.2 bits (50), Expect = 3.4 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +1 Query: 409 DIFFFLEDGTIKVIEPKTENSGLSQGTLISRQRIRLPFSYD 531 D+F +D I+P NS L SR +R PF +D Sbjct: 399 DVFISWKD----TIDPAACNSNPKDYLLYSRDPVRTPFQWD 435 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 333 VLIIHDPSWKIRCLFPTV 280 +L IH PS ++ CLF + Sbjct: 297 ILTIHQPSSELYCLFDKI 314 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 333 VLIIHDPSWKIRCLFPTV 280 +L IH PS ++ CLF + Sbjct: 297 ILTIHQPSSELYCLFDKI 314 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 333 VLIIHDPSWKIRCLFPTV 280 +L IH PS ++ CLF + Sbjct: 275 ILTIHQPSSELYCLFDKI 292 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 506 LWRLIKVPCDNPLFSVFGSITFIV 435 LW+ I P + SVF +T ++ Sbjct: 257 LWKYISTPSYRKMMSVFDDLTALI 280 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 559,662 Number of Sequences: 2352 Number of extensions: 10212 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -