BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d10 (722 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces... 182 6e-47 SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 28 1.2 SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyc... 27 3.6 SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosac... 26 4.7 SPAC2F3.12c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 8.3 >SPAC664.05 |rpl13||60S ribosomal protein L13|Schizosaccharomyces pombe|chr 1|||Manual Length = 208 Score = 182 bits (442), Expect = 6e-47 Identities = 97/199 (48%), Positives = 126/199 (63%), Gaps = 1/199 (0%) Frame = +2 Query: 53 IPNGHFHKDWQRFVKTWFNQPARRYRRKQNRIXXXXXXXXXXXXXXLRPIVRCPTVRYHT 232 +PN HFHKDWQR+VKTWFNQP R+ RR+Q R +RP V+ PT+RY+ Sbjct: 9 LPNAHFHKDWQRYVKTWFNQPGRKLRRRQAR-QTKAAKIAPRPVEAIRPAVKPPTIRYNM 67 Query: 233 KVRAGRGFTLREIRAAGLNPVFARTIGIAVDPRRRNKSVESLQINVQRIKEYRARLILFP 412 KVRAGRGFTL E++AAG++ A TIGI VD RRRN+S ESLQ NV+RIK Y A LI+FP Sbjct: 68 KVRAGRGFTLEELKAAGVSRRVASTIGIPVDHRRRNRSEESLQRNVERIKVYLAHLIVFP 127 Query: 413 -KGKKVLKGEANEEERKLATQLRGPLMPVQQPAPKSVARPITEDEKNFKAYQYLRGARSI 589 K + KG+A + T + ++P+ Q A + A+PITE+ KNF A+ L R+ Sbjct: 128 RKAGQPKKGDATDVSGAEQTDV-AAVLPITQEAVEE-AKPITEEAKNFNAFSTLSNERAY 185 Query: 590 AKLVGIRAKRLKDAAENPD 646 A+ G RA K AE + Sbjct: 186 ARYAGARAAFQKKRAEEAE 204 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 28.3 bits (60), Expect = 1.2 Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 4/44 (9%) Frame = -2 Query: 265 TKSESSTGAYFSM----VPNSWASHYRT*RPSCRTWSYGLSFLY 146 T +STG+Y M + W S T C TWSY S+ Y Sbjct: 1215 TVQGTSTGSYICMPHFQIQYDWCSAGVTDMSECNTWSYQKSYDY 1258 >SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1085 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 548 NFKAYQYLRGARSIAKLVGIRAKRLKDAAEN 640 N ++ ++LR A S A++VG +R++ EN Sbjct: 843 NNRSEEFLRNAASQAEIVGANKERIQKTVEN 873 >SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 26.2 bits (55), Expect = 4.7 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 431 KGEANEEERKLATQLRGPLMPVQQPAPKSVARPITEDE 544 + E N ++ + TQ + PV++ PK + P+T E Sbjct: 470 RDEDNHQKEETVTQPKREKTPVEKSFPKPASSPVTFSE 507 >SPAC2F3.12c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 279 Score = 25.4 bits (53), Expect = 8.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 246 VEDSLFVKLGPQD*TQYLPERLELL 320 +ED+LF +L D T Y +RLE+L Sbjct: 95 LEDALFSQLDEFDDTAYREQRLEML 119 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,827,336 Number of Sequences: 5004 Number of extensions: 56833 Number of successful extensions: 156 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 154 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -