BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d07 (428 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB032251-1|BAA89208.1| 2781|Homo sapiens bromodomain PHD finger ... 30 3.8 L41840-1|AAC41758.1| 3224|Homo sapiens nucleoporin protein. 29 6.7 D42063-1|BAA07662.1| 3224|Homo sapiens RanBP2 (Ran-binding prote... 29 6.7 AY282495-1|AAP22284.1| 2764|Homo sapiens bromodomain PHD finger ... 29 6.7 AC010095-2|AAY14984.1| 3224|Homo sapiens unknown protein. 29 6.7 AB209483-1|BAD92720.1| 3138|Homo sapiens RAN binding protein 2 v... 29 6.7 AJ580919-1|CAE45645.1| 119|Homo sapiens voltage-gated sodium ch... 29 8.8 >AB032251-1|BAA89208.1| 2781|Homo sapiens bromodomain PHD finger transcription factor protein. Length = 2781 Score = 29.9 bits (64), Expect = 3.8 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 157 QLASSPRRFHFSTSIYRIYVQKVW*LDVWQRLPSDTKSYKETSKRVKEK 303 Q+ S PR F + +I V+ V L +W+ T+ ++ TS +EK Sbjct: 673 QMCSKPREFALALAILECAVKPVVMLPIWREFLGHTRLHRMTSIEREEK 721 >L41840-1|AAC41758.1| 3224|Homo sapiens nucleoporin protein. Length = 3224 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 60 VLRKRGDEKPSDIVMFHQVRNPLPQPGAFLKIPIGFESS 176 +L RGD+ + V PLP+PG F K PI +S Sbjct: 953 ILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPIAAHAS 991 >D42063-1|BAA07662.1| 3224|Homo sapiens RanBP2 (Ran-binding protein 2) protein. Length = 3224 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 60 VLRKRGDEKPSDIVMFHQVRNPLPQPGAFLKIPIGFESS 176 +L RGD+ + V PLP+PG F K PI +S Sbjct: 953 ILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPIAAHAS 991 >AY282495-1|AAP22284.1| 2764|Homo sapiens bromodomain PHD finger transcription factor protein. Length = 2764 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 157 QLASSPRRFHFSTSIYRIYVQKVW*LDVWQRLPSDTKSYKETSKRVKEK 303 Q+ S PR F + +I V+ V L +W+ T+ ++ TS +EK Sbjct: 799 QMCSKPREFALALAILECAVKPVVMLPIWRESLGHTRLHRMTSIEREEK 847 >AC010095-2|AAY14984.1| 3224|Homo sapiens unknown protein. Length = 3224 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 60 VLRKRGDEKPSDIVMFHQVRNPLPQPGAFLKIPIGFESS 176 +L RGD+ + V PLP+PG F K PI +S Sbjct: 953 ILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPIAAHAS 991 >AB209483-1|BAD92720.1| 3138|Homo sapiens RAN binding protein 2 variant protein. Length = 3138 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 60 VLRKRGDEKPSDIVMFHQVRNPLPQPGAFLKIPIGFESS 176 +L RGD+ + V PLP+PG F K PI +S Sbjct: 867 ILSPRGDDYFNYNVQQTSTNPPLPEPGYFTKPPIAAHAS 905 >AJ580919-1|CAE45645.1| 119|Homo sapiens voltage-gated sodium channel alpha subunit Nav1.7 protein. Length = 119 Score = 28.7 bits (61), Expect = 8.8 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +2 Query: 158 NWLRVLGGSTLVLAFIGFMYKKFGSWMFGK 247 N + LG TLVLA I F++ G +FGK Sbjct: 22 NSVGALGNHTLVLAIIVFIFAVVGMQLFGK 51 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,761,672 Number of Sequences: 237096 Number of extensions: 1111068 Number of successful extensions: 1813 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1813 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3373625546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -