BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d07 (428 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014297-2305|AAN13731.1| 91|Drosophila melanogaster CG5184-PB... 31 0.50 AE014297-420|AAF51901.1| 274|Drosophila melanogaster CG15591-PA... 27 8.1 >AE014297-2305|AAN13731.1| 91|Drosophila melanogaster CG5184-PB, isoform B protein. Length = 91 Score = 31.5 bits (68), Expect = 0.50 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -2 Query: 262 CPMATFAKHPTTKLFVHKSDK 200 CP ATFA HPTT+LF + K Sbjct: 67 CPSATFAFHPTTQLFPSRITK 87 >AE014297-420|AAF51901.1| 274|Drosophila melanogaster CG15591-PA protein. Length = 274 Score = 27.5 bits (58), Expect = 8.1 Identities = 16/38 (42%), Positives = 22/38 (57%) Frame = +3 Query: 138 GAFLKIPIGFESSAVPL*Y*HLSDLCTKSLVVGCLAKV 251 GA + IP+ + VPL Y L+ L K+L+V LA V Sbjct: 178 GAMIMIPLLLGGTIVPLAYGALAMLAGKALIVSKLALV 215 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,496,600 Number of Sequences: 53049 Number of extensions: 322612 Number of successful extensions: 795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 795 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1334434944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -