BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d05 (740 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.15 |vps53||GARP complex subunit Vps53 |Schizosaccharomy... 27 2.1 SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe... 27 2.8 SPAC3G6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 27 3.7 SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosacchar... 27 3.7 SPBC3H7.09 |mug142||palmitoyltransferase|Schizosaccharomyces pom... 26 4.9 SPBC14F5.03c |kap123||karyopherin Kap123|Schizosaccharomyces pom... 26 4.9 SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizo... 26 6.5 >SPAC3A12.15 |vps53||GARP complex subunit Vps53 |Schizosaccharomyces pombe|chr 1|||Manual Length = 756 Score = 27.5 bits (58), Expect = 2.1 Identities = 21/65 (32%), Positives = 32/65 (49%) Frame = +1 Query: 355 RFQIQEIIYPARNNNVKLEVELKDSEDHDKIAVAAVLQLSNADITNLLKYIKTRLFENSM 534 R E IY K E+ + E DK++ + VL++ ++ LLK+ T FEN + Sbjct: 463 RLNTAEYIYRTTIELEKRFQEISNKEFKDKMSFSEVLEVISSSRGTLLKF-ATGKFEN-V 520 Query: 535 LKDDL 549 L DL Sbjct: 521 LNSDL 525 >SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe|chr 2|||Manual Length = 527 Score = 27.1 bits (57), Expect = 2.8 Identities = 16/58 (27%), Positives = 26/58 (44%) Frame = +1 Query: 175 VVDHPQIALAAITSYKKQIEISEFINFLLEALERNAVWLNTLVGNQNNFKCALMVGAG 348 V DH I A +T YK + + + +N L L+ + ++ N L+ GAG Sbjct: 296 VEDHSHIVFAQLTHYKNKKDEKKALNLLAWILKLYSYMSLFILFGSNYSDIVLLFGAG 353 >SPAC3G6.07 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 125 Score = 26.6 bits (56), Expect = 3.7 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 463 LQLSNADITNLLKYIKTRLFENSMLKDDLLKGK 561 + L+ AD T +L+++KT + + S + DD + K Sbjct: 69 IDLTKADQTEVLQFLKTYVEDESFVGDDFVMPK 101 >SPAPB1A10.07c |||sphingolipid biosynthesis protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 441 Score = 26.6 bits (56), Expect = 3.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 665 TVVRHLVGLLITILSITRYCLSLKGLNKA 579 TV ++VGL++TIL+ +C S N+A Sbjct: 206 TVGMYVVGLVLTILTYVFFCASSCSFNQA 234 >SPBC3H7.09 |mug142||palmitoyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 26.2 bits (55), Expect = 4.9 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +1 Query: 259 LEALERNAVWLNTLVGNQN 315 +E L+ + +WLNT +G +N Sbjct: 205 VEYLDHHCIWLNTCIGRRN 223 >SPBC14F5.03c |kap123||karyopherin Kap123|Schizosaccharomyces pombe|chr 2|||Manual Length = 1067 Score = 26.2 bits (55), Expect = 4.9 Identities = 7/22 (31%), Positives = 17/22 (77%) Frame = -3 Query: 474 AKLQDCGHCYFVVIFRVFQLDF 409 ++L++C C++ V+ RV++ +F Sbjct: 568 SRLRECSFCFYAVLARVYKEEF 589 >SPBC16C6.09 |ogm4|oma4|protein O-mannosyltransferase Ogm4|Schizosaccharomyces pombe|chr 2|||Manual Length = 778 Score = 25.8 bits (54), Expect = 6.5 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 286 IRHYAPVLLKGSL*IHLFRSVFCRMLLQPRLFVGDQLP 173 + HY P L GSL + F + CR + + G +P Sbjct: 671 LHHYLPAHLAGSLLVGAFIQLACRKSFRSPVSAGVPIP 708 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,943,120 Number of Sequences: 5004 Number of extensions: 61254 Number of successful extensions: 176 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 176 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 351258950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -