BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d05 (740 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81554-5|CAB04510.2| 401|Caenorhabditis elegans Hypothetical pr... 34 0.12 AF106579-7|AAC78199.2| 391|Caenorhabditis elegans Hypothetical ... 28 8.0 AF016686-5|ABO16458.1| 407|Caenorhabditis elegans Hypothetical ... 28 8.0 >Z81554-5|CAB04510.2| 401|Caenorhabditis elegans Hypothetical protein F57G4.8 protein. Length = 401 Score = 33.9 bits (74), Expect = 0.12 Identities = 23/92 (25%), Positives = 42/92 (45%) Frame = +1 Query: 178 VDHPQIALAAITSYKKQIEISEFINFLLEALERNAVWLNTLVGNQNNFKCALMVGAGPNR 357 +D L+ T +S FI + E R+A+ + + + +FK A ++ PN+ Sbjct: 278 MDDETYKLSKSTGIDNFFHLSHFIISVQEFTTRDAMKIKNIFMKEPSFKYAKILAEIPNQ 337 Query: 358 FQIQEIIYPARNNNVKLEVELKDSEDHDKIAV 453 +I + YPA + L ++ D DK A+ Sbjct: 338 MEILRVFYPAYSE--PLPPGVRYETDGDKFAL 367 >AF106579-7|AAC78199.2| 391|Caenorhabditis elegans Hypothetical protein F54E2.1 protein. Length = 391 Score = 27.9 bits (59), Expect = 8.0 Identities = 26/98 (26%), Positives = 43/98 (43%), Gaps = 9/98 (9%) Frame = +1 Query: 229 IEISEFINFLLEALERNAVWLNTLVGNQNNFKC------ALMVGAG-PNRFQIQEIIYPA 387 I IS + F +L + + LNTL+GN K +L V A + F + I Sbjct: 3 ISISLLLTFCKLSLAQQVIPLNTLIGNNFENKIDVTPPFSLYVSAQMDSDFNLNNIYVKT 62 Query: 388 RNNNVKLEVELKDSEDHDKIAVAAVLQLSNADI--TNL 495 +N +K +L+ S H + + Q ++ + TNL Sbjct: 63 MDNQIKSLKDLRHSRQHAESGPISPFQATSQTLITTNL 100 >AF016686-5|ABO16458.1| 407|Caenorhabditis elegans Hypothetical protein R07C3.7 protein. Length = 407 Score = 27.9 bits (59), Expect = 8.0 Identities = 23/74 (31%), Positives = 34/74 (45%) Frame = +1 Query: 397 NVKLEVELKDSEDHDKIAVAAVLQLSNADITNLLKYIKTRLFENSMLKDDLLKGKSMGVG 576 N+K++ L SE+ DKI A LS+ + L KT F+N M++ L G G Sbjct: 236 NLKVQHLLIPSEELDKILEAIRPNLSSLESLESLTIEKTYEFQNPMVQAIPLIILKYGYG 295 Query: 577 FALLRPFNDKQYRV 618 + L N R+ Sbjct: 296 YHTLLRINTGYPRI 309 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,058,604 Number of Sequences: 27780 Number of extensions: 335315 Number of successful extensions: 732 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -