BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d05 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 23 3.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 7.0 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 23.0 bits (47), Expect = 3.0 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 528 FDVERRSSKRQIDGSRFRLIETF*R*AISCNGKNCYQQP 644 FD + R +K IDG F L A+S N Y P Sbjct: 229 FDYDPRYAKMTIDGESFTLKNGICGMALSPVTNNLYYSP 267 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 7.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 444 FVVIFRVFQLDF*FYIVIPC 385 FVVI R L + F +++PC Sbjct: 223 FVVIIRRRTLYYFFNLIVPC 242 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,860 Number of Sequences: 438 Number of extensions: 4124 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -