BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d04 (658 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14461| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_18373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_14090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_35435| Best HMM Match : ABC_tran (HMM E-Value=6.2) 28 5.8 SB_58812| Best HMM Match : Paramecium_SA (HMM E-Value=3.4) 28 5.8 SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.7 SB_43092| Best HMM Match : 7tm_1 (HMM E-Value=0.23) 28 7.7 >SB_14461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 51.2 bits (117), Expect = 7e-07 Identities = 39/118 (33%), Positives = 68/118 (57%), Gaps = 3/118 (2%) Frame = +3 Query: 288 DTLEKKAVHLRLV--LEKDFKAADLKWSLFVAAAFSFRYESCLRPFPPAFMK-SGIKDMD 458 D++EK+ R++ L D A DL+ LFVAA S+R++S LRP+PP ++ G K++ Sbjct: 3 DSVEKETQLERVIGKLRSDGFACDLRMCLFVAALESYRHDSILRPYPPVGLREDGSKNIQ 62 Query: 459 ELLSVITDVPALDLVLQQLDNLEALPNISDIIDLLFYVLVRLKEPTLKTVPTDVHEXI 632 +L ++ + +P+L L LE P + ++D +VL LK+ +KT+ + + I Sbjct: 63 KLTNLSSSIPSLS-ALNNDSCLE--PGVWSLLD---WVL--LKKFDVKTLDKSMFQEI 112 >SB_18373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +3 Query: 237 NIASVSETMSDINQTKLDTLEKKAVHLRLVLEKDFKAADLK 359 + A ++ + D+N TL+K+ +HL+ V E + + D K Sbjct: 76 SFAGIASKIMDVNSMNSRTLDKEIMHLKRVQEAEDRKEDRK 116 >SB_14090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +3 Query: 237 NIASVSETMSDINQTKLDTLEKKAVHLRLVLEKDFKAADLK 359 + A ++ + D+N TL+K+ +HL+ V E + + D K Sbjct: 262 SFAGIASKIMDVNSMNSRTLDKEIMHLKRVQEAEDRKEDRK 302 >SB_35435| Best HMM Match : ABC_tran (HMM E-Value=6.2) Length = 181 Score = 28.3 bits (60), Expect = 5.8 Identities = 20/87 (22%), Positives = 39/87 (44%), Gaps = 4/87 (4%) Frame = +3 Query: 342 KAADLKWSLFVAAAFSFRYESCL----RPFPPAFMKSGIKDMDELLSVITDVPALDLVLQ 509 K AD SL RY++ L +PFP FM+ ++ + + A++ +L Sbjct: 91 KEADYLLSLAETQESIARYQTSLVFVIKPFPECFMEDNVRLSPRIDEAVAFTAAMEALLH 150 Query: 510 QLDNLEALPNISDIIDLLFYVLVRLKE 590 +L L ++ D+ + + V ++ E Sbjct: 151 RLQITYTLIDVLDVQERVNIVKEKIAE 177 >SB_58812| Best HMM Match : Paramecium_SA (HMM E-Value=3.4) Length = 327 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +1 Query: 448 KTWTNCLV*SLTCQLWIWCYNNWIIWKRCQISVISSTYCFTS 573 K++ NC V S TC + Y N + +K C VIS C S Sbjct: 3 KSYLNC-VPSKTCTAMVKSYLNCVPFKTCTAMVISYLNCVPS 43 >SB_57006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -3 Query: 491 SWHVSDYTKQFVHVFDATFHKSRRKR 414 +W + ++ ++F H+F F K R KR Sbjct: 577 AWRMEEFRREFKHIFIGCFRKLRCKR 602 >SB_43092| Best HMM Match : 7tm_1 (HMM E-Value=0.23) Length = 417 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -3 Query: 491 SWHVSDYTKQFVHVFDATFHKSRRKR 414 +W + ++ ++F H+F F K R KR Sbjct: 390 AWRMEEFRREFKHIFIGCFRKLRCKR 415 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,407,109 Number of Sequences: 59808 Number of extensions: 346199 Number of successful extensions: 888 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 801 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -