BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10d01 (689 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizos... 27 2.6 SPBC713.03 |||D-lactate dehydrogenase |Schizosaccharomyces pombe... 26 4.5 >SPCC1442.07c |||ubiquitin/metalloprotease fusion protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 27.1 bits (57), Expect = 2.6 Identities = 13/22 (59%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = +2 Query: 368 PARHTSHDSVTLI*CHN-GSHL 430 PA HT HDS TL HN G+H+ Sbjct: 157 PAEHTRHDSKTLGLNHNQGAHI 178 >SPBC713.03 |||D-lactate dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 526 Score = 26.2 bits (55), Expect = 4.5 Identities = 18/61 (29%), Positives = 29/61 (47%) Frame = -2 Query: 376 SCRAGGIAHTADRAVDTVED*SWHGTGSESNLVEKTGSLVSHFA*KLTEANTGAEDRNLH 197 SC+ GG A TA + + S HG+ V G+++ + L + NTG + + L Sbjct: 194 SCQVGGCAATAAGGLRLLRYGSLHGSILGMEAVLPDGTILDNLV-TLRKDNTGLDIKQLF 252 Query: 196 I 194 I Sbjct: 253 I 253 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,643,038 Number of Sequences: 5004 Number of extensions: 50351 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -