SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte10d01
         (689 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr...    27   0.22 
DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450 monoo...    23   2.1  

>AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein
           protein.
          Length = 1308

 Score = 26.6 bits (56), Expect = 0.22
 Identities = 12/35 (34%), Positives = 18/35 (51%)
 Frame = +1

Query: 409 MSQW*PPRNTTVLEKKSRPMETAERRRVAPKKRMK 513
           +++W PPR     E K RP    ER     ++RM+
Sbjct: 571 VAEWEPPRALWPTEWKVRPSTVEEREEFRRQERMR 605


>DQ244074-1|ABB36784.1|  517|Apis mellifera cytochrome P450
           monooxygenase protein.
          Length = 517

 Score = 23.4 bits (48), Expect = 2.1
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -3

Query: 204 IFIFVTYHRAAW 169
           I IFVT HR AW
Sbjct: 18  ILIFVTSHRPAW 29


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 184,126
Number of Sequences: 438
Number of extensions: 3935
Number of successful extensions: 7
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 21073995
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -