BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c24 (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 3.1 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 4.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.1 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 7.1 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.1 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 9.3 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.6 bits (46), Expect = 3.1 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = -3 Query: 382 KVTRSRPPGHAP----RGAHPSGRIPGTPGSPARTPAKI-TSRNS 263 K++ PP A +G HP + P SP+ TP+ + T R S Sbjct: 46 KLSNKSPPPLADAAVGKGFHPWKKSPQGAPSPSSTPSSLPTQRTS 90 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 344 WGSSFWPYTRDARVSSSY 291 WG+S WP T D +S Y Sbjct: 479 WGASQWPDTPDL-ISDGY 495 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 379 PWLSTSETRRARTYCCLLTTSSDLRKP 459 PW +T+ TRR T TT+S +P Sbjct: 1050 PWWTTTTTRRTTT--TRPTTTSTTTRP 1074 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 325 RIPGTPGSPARTPA 284 R PGTPG ++ PA Sbjct: 90 RSPGTPGPLSQAPA 103 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 325 RIPGTPGSPARTPA 284 R PGTPG ++ PA Sbjct: 246 RSPGTPGPLSQAPA 259 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.0 bits (42), Expect = 9.3 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -1 Query: 642 RWRARGPWSRLSER 601 RWR G WS S + Sbjct: 180 RWRMEGDWSDCSSQ 193 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,336 Number of Sequences: 336 Number of extensions: 2458 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -