BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c22 (736 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 24 4.2 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 5.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 5.6 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 23 7.4 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 23 9.8 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 24.2 bits (50), Expect = 4.2 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -1 Query: 718 EARN-PAVPLLQINSRRKLKKPTAYCNPNSPMATKPI 611 EAR+ +PL ++ RRK +K T N P+ T P+ Sbjct: 320 EARDFQFIPLDTVDLRRKRQKLTGSSNVFLPVVTAPL 356 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 5.6 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = +3 Query: 93 FSNFVFLYCVSFVLF 137 F NF+F++ + FVLF Sbjct: 52 FINFIFMFLLHFVLF 66 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.8 bits (49), Expect = 5.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 107 VLILC*FCVIF*LVFILICEDLNKK 181 V+ L CV+F + F+L NKK Sbjct: 772 VMALILLCVVFGIAFVLFSRHKNKK 796 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 23.4 bits (48), Expect = 7.4 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +1 Query: 412 WWPVSLHSAVSPCSCTASVDASGASM 489 W P S+H P VD+ GA + Sbjct: 5 WIPTSVHGPYPPHMVPGGVDSDGAQI 30 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 23.0 bits (47), Expect = 9.8 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -1 Query: 721 KEARNPAVPLLQINSRRKLKKPTAYCNPNSPMATKP 614 ++ + P VP + NS+ + +PT P + +KP Sbjct: 635 QQQQPPVVPPPRTNSQSQASEPTPALPPRADRDSKP 670 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,240 Number of Sequences: 2352 Number of extensions: 15647 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -