BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c20 (550 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G8.06c |||dihydroxy-acid dehydratase|Schizosaccharomyces p... 28 0.79 SPAC3F10.04 |gsa1|gsh2|glutathione synthetase large subunit Gsa1... 26 3.2 SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory sub... 25 7.3 >SPAC17G8.06c |||dihydroxy-acid dehydratase|Schizosaccharomyces pombe|chr 1|||Manual Length = 598 Score = 28.3 bits (60), Expect = 0.79 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 91 IAKLASVPLEKPGFDALNMTAPFMVQMNPDGKW 189 IAK + L F A++ PF+ M P GK+ Sbjct: 318 IAKSVGITLTLDDFQAVSNRTPFIADMKPSGKY 350 >SPAC3F10.04 |gsa1|gsh2|glutathione synthetase large subunit Gsa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 498 Score = 26.2 bits (55), Expect = 3.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 256 SKAVAAAHSYCTQCTSGNQKNDSKSNYVPV 345 SKAV+ H+YC+Q SG + +NY+ V Sbjct: 158 SKAVSNLHAYCSQ--SGLYRKPLTTNYLTV 185 >SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory subunit Ekc1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 838 Score = 25.0 bits (52), Expect = 7.3 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Frame = +1 Query: 190 NSCKPENLDEERLKAVVQYLVKSKAVAAAHSYCTQCTSGNQ---KNDSKSNYVPVIMMPI 360 NS E + + + + Y+ SKA +A S + + KN+S + PV+ MP+ Sbjct: 246 NSLSRELVSRQTITTLTDYMTDSKAPHSATSLINGVSIVIELIRKNNSDYDVTPVLQMPL 305 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,828,631 Number of Sequences: 5004 Number of extensions: 30229 Number of successful extensions: 76 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -