Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte10c20
         (550 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF400226-1|AAL62061.1| 5171|Homo sapiens bullous pemphigoid anti...    30   4.6  

>AF400226-1|AAL62061.1| 5171|Homo sapiens bullous pemphigoid antigen 1
            eA protein.
          Length = 5171

 Score = 30.3 bits (65), Expect = 4.6
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +1

Query: 106  SVPLEKPGFDALNMTAPFMVQMNPDGKWNSCKPENLDEERLKAVVQYLVKSKAVAAAHSY 285
            S+   KP  D +N T P +++++P G+  S + + +  + L + ++  VK +AVA   + 
Sbjct: 3574 SIAEHKPHIDKMNKTGPQLLELSP-GEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEA- 3631

Query: 286  CTQCTSGNQKND 321
             +Q T  + K D
Sbjct: 3632 ISQSTQFHDKID 3643


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 62,080,060
Number of Sequences: 237096
Number of extensions: 1050392
Number of successful extensions: 2156
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2123
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2156
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5421005376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)