BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c19 (642 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 2.8 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 22 3.7 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 3.7 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 6.5 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 8.6 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.6 bits (46), Expect = 2.8 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 349 VLPLCAVCILHER 387 V+PLC C LH R Sbjct: 209 VMPLCKSCDLHHR 221 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -1 Query: 501 GVLQISCQRRYKPRVLFSALNTSPV*SSLDEALFSIP 391 G L +S +Y+PR+L +T+ +F+ P Sbjct: 135 GQLVLSSMHKYQPRILIVKASTAQALGWAPTNVFTFP 171 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -2 Query: 302 LTTNPA*IHPTIAP-HYQSITTSLPP 228 L TNPA HP + P +Q+ + PP Sbjct: 50 LPTNPAFFHPGLLPLAWQANSPPSPP 75 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 6.5 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 3/49 (6%) Frame = -2 Query: 497 SYKS-PASVGTNHESYSVL*TPHLFKARSMK--PYSLSLARSCKMQTAQ 360 +Y+S P S+G + + S HL +AR + PY S+A +CK+ +++ Sbjct: 35 AYRSFPLSLGMSPYASSQHHHHHL-QARPPQDSPYDASVAAACKLYSSE 82 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 21.0 bits (42), Expect = 8.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -3 Query: 265 PHTINLLPPRCLPSF 221 PH+ PPRC P + Sbjct: 23 PHSPEPYPPRCPPIY 37 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,977 Number of Sequences: 336 Number of extensions: 2798 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -