BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c18 (742 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 27 0.21 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 6.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.9 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 7.9 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 26.6 bits (56), Expect = 0.21 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +2 Query: 401 KTIMGSYSGCNVLA*IWKKKNLACTRPVLDWNSNDYSIILC 523 KT M ++S + +WK N+ P ++N N LC Sbjct: 396 KTTMSTFSDITFMRTVWKFFNIFLITPFYNFNENTIHSKLC 436 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/29 (31%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +3 Query: 126 ANIKAIRAAIMTLTKRKNSP-ENEELIEN 209 AN+ + L KRK+SP + + +++N Sbjct: 68 ANVSPSKTKFFNLIKRKDSPVQKKHILKN 96 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = +3 Query: 42 IRETYL*YYVSFIKSISIFILVWS*FKTANIKAIRAAIMTLTKRKN 179 ++ TY+ + V F+K ++I + + A + MT +KN Sbjct: 48 VKRTYIEWGVKFLKVVTIITVFFVVLGAAVVSKGTTLFMTSQIKKN 93 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/46 (23%), Positives = 22/46 (47%) Frame = +3 Query: 42 IRETYL*YYVSFIKSISIFILVWS*FKTANIKAIRAAIMTLTKRKN 179 ++ TY+ + V F+K ++I + + A + MT +KN Sbjct: 48 VKRTYIEWGVKFLKVVTIITVFFVVLGAAVVSKGTTLFMTSQIKKN 93 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.4 bits (43), Expect = 7.9 Identities = 9/29 (31%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +3 Query: 126 ANIKAIRAAIMTLTKRKNSP-ENEELIEN 209 AN+ + L KRK+SP + + +++N Sbjct: 68 ANVSPPKTKFFNLIKRKDSPVQKKHILKN 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,799 Number of Sequences: 336 Number of extensions: 3878 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -