BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c16 (688 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.7 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.8 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 22 4.8 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.3 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 367 GVVLLDNFMGNAFVILSIIVW 305 G ++L +GNA VILS+ + Sbjct: 44 GFLVLATVLGNALVILSVFTY 64 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 367 GVVLLDNFMGNAFVILSIIVW 305 G ++L +GNA VILS+ + Sbjct: 44 GFLVLATVLGNALVILSVFTY 64 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 615 EKRKKSLMKDASMNTNTDHDIA 680 ++R S+ + AS + NTD DIA Sbjct: 112 DERPNSIHQRASFSLNTDGDIA 133 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 367 GVVLLDNFMGNAFVILSIIVW 305 G ++L +GNA VILS+ + Sbjct: 44 GFLVLATVLGNALVILSVFTY 64 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -1 Query: 412 NFCNVSIFIGDSFLGGVVLLDNFMGNAFVILS 317 N C SI + F V DN + NAF L+ Sbjct: 111 NTCQPSIPLEPDFTSDVTERDNHLVNAFKTLT 142 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 22.2 bits (45), Expect = 4.8 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -2 Query: 150 GNVFPLSNVEKKAP 109 GN FP+ VEK++P Sbjct: 292 GNNFPVYQVEKRSP 305 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 676 IS*SVFVFIDASFIKDFFLFSIAFLRTS 593 +S ++ IDA KD F I LR + Sbjct: 342 LSYNMLTHIDARMFKDLFFLQILDLRNN 369 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,168 Number of Sequences: 438 Number of extensions: 3581 Number of successful extensions: 27 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -