BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c09 (602 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-92... 29 3.7 06_02_0334 + 14582925-14583404,14583533-14583540,14584070-145845... 27 8.7 >06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-927313, 927826-927897,928145-928236,928331-928403,928870-928944, 929207-929314,929372-929422,929834-929959,930324-930362, 930452-930535,931018-931109,931217-931300,931410-931524 Length = 415 Score = 28.7 bits (61), Expect = 3.7 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -2 Query: 556 DCFSLGTRPGDAPDFFRDIFSSLLFATRSVRFHYGF 449 D F G G DFFR+IF F+ +FH F Sbjct: 167 DIFGGGGGGGGMNDFFRNIFREREFSGHDAKFHVPF 202 >06_02_0334 + 14582925-14583404,14583533-14583540,14584070-14584561, 14584733-14585087,14585338-14585505 Length = 500 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 46 RVGSMYFETQMDKSRSARYVV 108 RVG Y ETQ DK R+ ++++ Sbjct: 419 RVGGTYRETQHDKERTKKFII 439 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,137,260 Number of Sequences: 37544 Number of extensions: 288107 Number of successful extensions: 562 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1431112012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -