BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c09 (602 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 >SB_38432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 601 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 2/55 (3%) Frame = +1 Query: 397 QVPSQEYFRPA--AVINQTRNRNESERIASRREGRKKYHGKNQVRPPVGCREKNS 555 ++ + ++ R A A + QT N E++R AS RK+ H +Q + + ++KN+ Sbjct: 353 EMKASKHLREAIFATLQQTANDLEAQRKASEYSFRKRIHETDQAKSELEWQQKNT 407 >SB_13504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4924 Score = 27.9 bits (59), Expect = 6.7 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = -1 Query: 539 HPTGGRTXXXXXXXFLPSLRDAIRSLSLRFRV*FITAAGLKYSCDGTW-CRTL 384 +PT G+ FLPSLR R L +FR+ G +YS T C+ L Sbjct: 2189 NPTQGKPCVNSDFTFLPSLRSENRELVAKFRLSNTPGKGTRYSYFSTMSCQIL 2241 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,438,076 Number of Sequences: 59808 Number of extensions: 333773 Number of successful extensions: 607 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 607 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -