BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c08 (705 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q3YQV4 Cluster: Pentapeptide repeat domain protein; n=6... 34 3.9 UniRef50_A6LZM3 Cluster: Putative uncharacterized protein; n=1; ... 33 9.0 >UniRef50_Q3YQV4 Cluster: Pentapeptide repeat domain protein; n=6; canis group|Rep: Pentapeptide repeat domain protein - Ehrlichia canis (strain Jake) Length = 635 Score = 33.9 bits (74), Expect = 3.9 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +1 Query: 124 GLHLCTVIFNFERIKSSNLKNSQRKNVCMQTDNIETKSI 240 GL L V F+F ++SS+ KNSQ KNV N+E + Sbjct: 573 GLKLENVNFSFADLQSSHFKNSQLKNVDFSNANLENADL 611 >UniRef50_A6LZM3 Cluster: Putative uncharacterized protein; n=1; Clostridium beijerinckii NCIMB 8052|Rep: Putative uncharacterized protein - Clostridium beijerinckii NCIMB 8052 Length = 410 Score = 32.7 bits (71), Expect = 9.0 Identities = 17/48 (35%), Positives = 26/48 (54%) Frame = -1 Query: 669 SVTLLIYLLFYSNVYTISRI*APNNKDAQITASVSISETFLNIFVLFC 526 SV +LIY L V+T+S I NN+ ++ S+ + NI +FC Sbjct: 291 SVKVLIYTLLSFGVFTLSFIYLINNRKREVGILYSLGASKKNIIFMFC 338 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,907,872 Number of Sequences: 1657284 Number of extensions: 10706042 Number of successful extensions: 25568 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25539 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56198352344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -