BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c08 (705 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 25 3.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 24 5.4 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 7.1 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 24.6 bits (51), Expect = 3.1 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +1 Query: 28 FYNGTNRNACI----FFHLLAMKYSSCLNTITVII 120 FYNGTN++ I F + KY+ N TV+I Sbjct: 166 FYNGTNKDTVIKLSNAFRGIVEKYARKENQATVVI 200 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 383 RRKTIRRIAEKIVNACLLATISLAF 457 +RKTI RI ++ AC A S AF Sbjct: 463 KRKTIDRINRRLRRACRKAVKSQAF 487 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 7.1 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = +1 Query: 205 CMQTDNIETKSICVETCK 258 C++ N++ K C+++CK Sbjct: 489 CLECKNVKYKGKCLDSCK 506 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 640,566 Number of Sequences: 2352 Number of extensions: 11458 Number of successful extensions: 45 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -