BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c08 (705 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70212-5|CAA94165.3| 320|Caenorhabditis elegans Hypothetical pr... 28 5.7 U58754-4|AAX22292.1| 332|Caenorhabditis elegans Serpentine rece... 27 9.9 >Z70212-5|CAA94165.3| 320|Caenorhabditis elegans Hypothetical protein R04D3.7 protein. Length = 320 Score = 28.3 bits (60), Expect = 5.7 Identities = 9/41 (21%), Positives = 21/41 (51%) Frame = +3 Query: 36 WDEPKCLYFLSFTCYEIQFMFKYNNSYYNWTPFMYCDLQFR 158 W C +F +F CY + + + ++ WT F+ ++++ Sbjct: 74 WSYGPCRHFEAFICYSMMHVLQTSSLISGWTVFLTTFMKYQ 114 >U58754-4|AAX22292.1| 332|Caenorhabditis elegans Serpentine receptor, class sx protein15 protein. Length = 332 Score = 27.5 bits (58), Expect = 9.9 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +1 Query: 25 TFYNGTNRNACIFFHLLAMKYSSCLNTITVIIIGLH-LCTVIF 150 TFY+ R F+ + ++ CL T TV ++ L L T++F Sbjct: 75 TFYHYQIRRELCFYTMFPYVFAHCLQTGTVWVLSLDLLITILF 117 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,134,032 Number of Sequences: 27780 Number of extensions: 291467 Number of successful extensions: 806 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 787 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 806 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -