BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c06 (321 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871 35 0.012 08_01_0321 + 2872609-2873027,2873477-2873905,2874743-2874944,287... 29 0.81 04_04_1298 + 32448759-32448870,32449125-32449210,32449309-32449521 29 0.81 02_04_0413 + 22681957-22682035,22682253-22682788 28 1.9 12_02_0046 + 12830974-12832386 27 2.5 05_01_0251 + 1901709-1901864,1901968-1901999,1902534-1902664,190... 27 2.5 04_03_1017 + 21747044-21748051 27 2.5 11_06_0610 - 25449085-25453284 27 3.3 03_01_0515 - 3864796-3865425 27 3.3 08_01_0084 - 613255-613989 27 4.3 08_01_0082 - 588269-588434,590800-591653 27 4.3 02_05_1200 - 34922073-34922273,34922397-34922469,34922976-349230... 27 4.3 01_01_1208 + 9733010-9733114,9733920-9733979,9735254-9736280,973... 27 4.3 09_06_0292 + 22075647-22075691,22077394-22077507,22077602-220778... 26 7.6 09_03_0192 + 13344558-13344942,13345038-13345591 26 7.6 08_01_0083 - 604175-605776 26 7.6 07_03_1611 - 28136398-28136572,28137995-28138567,28138762-28139123 26 7.6 04_04_0187 - 23411085-23411477,23411626-23411631 26 7.6 02_05_1336 + 35773629-35773856,35773931-35774085,35774217-357745... 26 7.6 >01_01_1044 + 8231933-8231941,8232091-8232166,8232423-8232871 Length = 177 Score = 35.1 bits (77), Expect = 0.012 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +1 Query: 70 GYCPPVCSPPDCRPICGPASPLLCQSSVPP 159 G CPP C PP C C P PL C PP Sbjct: 128 GICPPPCPPP-CPLPCPPPCPLPCPPPCPP 156 >08_01_0321 + 2872609-2873027,2873477-2873905,2874743-2874944, 2875909-2875947,2876309-2876354,2877380-2877922, 2878827-2880847,2880972-2881215,2881642-2881684, 2881923-2881962,2883580-2883675,2883712-2883759, 2883964-2884290 Length = 1498 Score = 29.1 bits (62), Expect = 0.81 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 128 LRSFARAACHQHNGAIL*ILASTYTAVTLKLCNAMDDFYSE 250 +RSF C+ N ++ ++L CN M+D+Y E Sbjct: 829 VRSFVATECNNGNNSVAPPRFQVLRVLSLDKCNGMEDYYIE 869 >04_04_1298 + 32448759-32448870,32449125-32449210,32449309-32449521 Length = 136 Score = 29.1 bits (62), Expect = 0.81 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +1 Query: 91 SPPDCRPICGPASPLLCQSSVPPTQRCYPVNPCINIYSC 207 S PDC CG SP C + V + +C PC +Y C Sbjct: 89 SLPDCSHACGACSP--C-NRVMVSFKCSIAEPCPMVYRC 124 >02_04_0413 + 22681957-22682035,22682253-22682788 Length = 204 Score = 27.9 bits (59), Expect = 1.9 Identities = 20/49 (40%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +1 Query: 64 KMGYCPPVCSPPDCRPICGPASPLLCQSSVPPTQRC-YPVNPCINIYSC 207 K G C CS +C P P SP CQ PPT C +P PC C Sbjct: 143 KPGCCCCGCSGGECPP---PPSPP-CQHECPPTPPCEHP--PCSESGCC 185 >12_02_0046 + 12830974-12832386 Length = 470 Score = 27.5 bits (58), Expect = 2.5 Identities = 19/41 (46%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = +1 Query: 79 PPVCSPPDCRPICGP--ASPLLCQSSV---PPTQRCYPVNP 186 PPV SPP + I GP ASP QS V P C P P Sbjct: 279 PPVPSPPCAKKIRGPVSASPAARQSCVAASAPPPWCVPPPP 319 >05_01_0251 + 1901709-1901864,1901968-1901999,1902534-1902664, 1902740-1902821,1902928-1903054,1903369-1903686, 1903785-1903846,1903988-1904074,1904139-1904195, 1906113-1906197,1906916-1907185,1908158-1908254, 1908390-1908436,1908826-1908939,1909024-1909117, 1909360-1909457,1910356-1910455,1911445-1911521, 1911824-1913122 Length = 1110 Score = 27.5 bits (58), Expect = 2.5 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +1 Query: 28 FLNLQVYKLKK*KMGYCPPVCSPPDCRPICGPASPLLCQSSVPPTQRCYP 177 F+N Q + K GY + P + R P SP+ + + P T++C+P Sbjct: 807 FVNSQFFSALSRKEGYIHNL--PTEGRRNLVPRSPMTIEEAFPFTRQCWP 854 >04_03_1017 + 21747044-21748051 Length = 335 Score = 27.5 bits (58), Expect = 2.5 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +1 Query: 79 PPVCSPPDCRPICGPASPLLCQS---SVPPTQRCYP 177 PP + PD P P+SPL + +VPP +R +P Sbjct: 270 PPRAASPDYTPSTPPSSPLPSAAESFTVPPPRRYHP 305 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 27.1 bits (57), Expect = 3.3 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +1 Query: 79 PPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNP 186 PPV SPP P+ P P+ +S PP P P Sbjct: 1195 PPVKSPPPPAPVISPPPPV--KSPPPPAPVILPPPP 1228 Score = 26.6 bits (56), Expect = 4.3 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +1 Query: 79 PPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNP 186 PP+ SPP P+ P P+ +S PP P P Sbjct: 1163 PPIKSPPPPAPVISPPPPV--KSPPPPAPVILPPPP 1196 >03_01_0515 - 3864796-3865425 Length = 209 Score = 27.1 bits (57), Expect = 3.3 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +1 Query: 79 PPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPVNPCINIYS 204 PP SPP P P SP+ +SS PP PV +N Y+ Sbjct: 94 PPAASPPPPPPSPPPPSPV--KSSPPPPPAWSPVTN-VNDYT 132 >08_01_0084 - 613255-613989 Length = 244 Score = 26.6 bits (56), Expect = 4.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 175 DSTVVLVARCSGKGAEMQVHRSDDNPEVNRLVDN 74 D TV + RC+G+GAE VH + V+ +V + Sbjct: 102 DGTVTVALRCTGEGAEF-VHAAAPGVAVSDVVSS 134 >08_01_0082 - 588269-588434,590800-591653 Length = 339 Score = 26.6 bits (56), Expect = 4.3 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 175 DSTVVLVARCSGKGAEMQVHRSDDNPEVNRLVDN 74 D TV + RC+G+GAE VH + V+ +V + Sbjct: 104 DGTVTVALRCTGEGAEF-VHAAAPGVAVSDVVSS 136 >02_05_1200 - 34922073-34922273,34922397-34922469,34922976-34923019, 34923107-34923183,34923433-34923529,34923668-34924062, 34926577-34926620,34926702-34926770,34926856-34926956, 34927689-34927856,34927940-34928141,34928269-34928708, 34928786-34928884,34929123-34929263 Length = 716 Score = 26.6 bits (56), Expect = 4.3 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 139 CQSSVPPTQRCYPVNP 186 C SS+PPTQ Y NP Sbjct: 453 CDSSLPPTQSLYKGNP 468 >01_01_1208 + 9733010-9733114,9733920-9733979,9735254-9736280, 9736332-9736621 Length = 493 Score = 26.6 bits (56), Expect = 4.3 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 76 CPPVCSPPDCRPICGPASPLLCQSSVPPTQRCYP 177 CPP P P G +P++ VPP C+P Sbjct: 351 CPPSWPPQLMVPAPGICTPVVPIPLVPPLWSCFP 384 >09_06_0292 + 22075647-22075691,22077394-22077507,22077602-22077841, 22077926-22078003,22078094-22078162,22078420-22078545, 22079108-22079188,22079272-22079460,22079597-22080434, 22082290-22082411,22082482-22082701,22082910-22083055, 22083260-22083566,22083886-22084136,22084294-22084533, 22084930-22085238 Length = 1124 Score = 25.8 bits (54), Expect = 7.6 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +1 Query: 37 LQVYKLKK*KMGYCPPVCSPPDCRPICGPASPLLCQSSVPPTQRCYPV 180 + ++KL + PP PP RP+ G P + + VP TQ P+ Sbjct: 449 VHIHKLASHSQFHAPPHQPPPPERPVPG-IVPGIVRPPVPTTQITNPM 495 >09_03_0192 + 13344558-13344942,13345038-13345591 Length = 312 Score = 25.8 bits (54), Expect = 7.6 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +1 Query: 82 PVCSPPDCRPICGPASPLL 138 P+C P P+C SPLL Sbjct: 162 PLCIEPPSSPVCNAPSPLL 180 >08_01_0083 - 604175-605776 Length = 533 Score = 25.8 bits (54), Expect = 7.6 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 175 DSTVVLVARCSGKGAEMQVHRSDDNPEVNRLVDN 74 D TV + RC+G+GAE VH + V+ +V + Sbjct: 102 DLTVTVTLRCTGEGAEF-VHAAAPGVAVSDVVSS 134 >07_03_1611 - 28136398-28136572,28137995-28138567,28138762-28139123 Length = 369 Score = 25.8 bits (54), Expect = 7.6 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 141 PEQRATNTTVLSCKSLHQHIQLLHSNYVTQW 233 P++ ATN T L C ++ HSNY W Sbjct: 129 PDEEATNHTALPCPG-ELLVEEHHSNYGEPW 158 >04_04_0187 - 23411085-23411477,23411626-23411631 Length = 132 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 73 YCPPVCSPPDCRPICGPASPLLCQSSVPP 159 Y PP PP P C P P + PP Sbjct: 90 YWPPYWCPPPEDPTCKPCYPRYSYAPPPP 118 >02_05_1336 + 35773629-35773856,35773931-35774085,35774217-35774549, 35774615-35774927,35776992-35777168,35777281-35777397, 35777532-35777698,35777800-35778024,35778127-35778448, 35778542-35778786,35778993-35779131,35779212-35779304, 35779509-35779577 Length = 860 Score = 25.8 bits (54), Expect = 7.6 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = -3 Query: 130 EMQVHRSDDNPEVNRLVDNNPFFTFLIYRLVNLKNFTNI 14 E+ + D+N + L D + F + RL +KN T + Sbjct: 560 ELLYSKEDNNEHIGHLADRSKPIIFSMARLDKIKNITGL 598 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,331,812 Number of Sequences: 37544 Number of extensions: 177031 Number of successful extensions: 586 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 411066120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -