BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c01 (512 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 23 2.1 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 21 4.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.4 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 6.4 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 8.5 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 22.6 bits (46), Expect = 2.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 272 CDVLASSIKSAIPRI 228 CD L + IK A+P I Sbjct: 45 CDALGNQIKGALPEI 59 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.4 bits (43), Expect = 4.9 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 103 VFVSVNQRDIVLRLSKNITRVLVLKSI 183 +FV+V I+L + TR+++LKS+ Sbjct: 100 IFVNVFFWVIILMSNYAFTRIILLKSV 126 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 385 ILQGALNGRTGIKLYN*DLKLLL 317 I+QG TG+K N LK+L+ Sbjct: 230 IIQGGYISVTGLKRVNPKLKVLI 252 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.0 bits (42), Expect = 6.4 Identities = 10/35 (28%), Positives = 16/35 (45%) Frame = -1 Query: 344 IQLRLEALASRQHSHCHFHRLCPRCDVLASSIKSA 240 + L + AS QH H H P+ +S+ +A Sbjct: 41 LSLGMSPYASSQHHHHHLQARPPQDSPYDASVAAA 75 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 20.6 bits (41), Expect = 8.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 441 MLF*FCRYVLLLINYYI 491 ++F FC ++ L YYI Sbjct: 143 LVFVFCYFIYLFTVYYI 159 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,142 Number of Sequences: 336 Number of extensions: 2020 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12258909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -