BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c01 (512 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0681 + 18628107-18629346,18630476-18630486,18630836-186309... 28 5.1 06_01_0675 + 4937309-4937354,4937606-4937718,4937810-4937905,493... 27 6.7 >04_03_0681 + 18628107-18629346,18630476-18630486,18630836-18630943, 18631158-18631250 Length = 483 Score = 27.9 bits (59), Expect = 5.1 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -1 Query: 365 W*DRY*TIQLRLEALASRQHSHCHFHRLCPRCDVLASSIKSAI 237 W + T RLE ++ +CH HR+ +CD+ + A+ Sbjct: 371 WIFAFNTENNRLEEISPFSQENCHLHRIYLQCDLSKHLMNKAL 413 >06_01_0675 + 4937309-4937354,4937606-4937718,4937810-4937905, 4938003-4938059,4938145-4938300,4938402-4938486, 4938727-4938817,4938896-4939060,4939150-4939345, 4939593-4939731,4940187-4941874,4942575-4942765, 4942850-4942994 Length = 1055 Score = 27.5 bits (58), Expect = 6.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 257 SSIKSAIPRIRPWKLHEFALVPQQSILF 174 + ++SA R PW +FAL QS LF Sbjct: 385 NEVESAFKRAMPWLADDFALKDVQSALF 412 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,905,017 Number of Sequences: 37544 Number of extensions: 189558 Number of successful extensions: 368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 368 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -