BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c01 (512 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_5682| Best HMM Match : PH (HMM E-Value=0.23) 27 9.1 >SB_8469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 874 Score = 28.3 bits (60), Expect = 3.9 Identities = 12/27 (44%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 255 VDKIGHSSYKTMETSRIC-PCSATVNT 178 +D++ S Y+T+ TSR C C TV T Sbjct: 538 IDRVRKSRYQTVSTSRTCYSCQPTVGT 564 >SB_5682| Best HMM Match : PH (HMM E-Value=0.23) Length = 184 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 206 IREVSMVLYEEWPILSTRLVHHNVDRADGNDNVNAALKQELQ 331 + E ++ + +E+P+ + L+ + VDR DN+ L +LQ Sbjct: 98 MHEHALSVRDEFPLANLPLIGYTVDRPSEGDNIEKDLVFKLQ 139 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,419,690 Number of Sequences: 59808 Number of extensions: 238248 Number of successful extensions: 416 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -