BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10c01 (512 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC009221-1|AAH09221.2| 324|Homo sapiens TNPO3 protein protein. 29 7.2 AJ133769-1|CAB42643.1| 923|Homo sapiens nuclear transport recep... 29 7.2 AF145029-1|AAD38537.1| 975|Homo sapiens transportin-SR protein. 29 7.2 >BC009221-1|AAH09221.2| 324|Homo sapiens TNPO3 protein protein. Length = 324 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 188 VAEQGQIREVSMVLYEEWPILSTRLVHHNVD 280 + E GQ V+ E WP+LS L H D Sbjct: 40 IVENGQTHPCQKVIQEIWPVLSETLNKHRAD 70 >AJ133769-1|CAB42643.1| 923|Homo sapiens nuclear transport receptor protein. Length = 923 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 188 VAEQGQIREVSMVLYEEWPILSTRLVHHNVD 280 + E GQ V+ E WP+LS L H D Sbjct: 625 IVENGQTHPCQKVIQEIWPVLSETLNKHRAD 655 >AF145029-1|AAD38537.1| 975|Homo sapiens transportin-SR protein. Length = 975 Score = 29.5 bits (63), Expect = 7.2 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 188 VAEQGQIREVSMVLYEEWPILSTRLVHHNVD 280 + E GQ V+ E WP+LS L H D Sbjct: 659 IVENGQTHPCQKVIQEIWPVLSETLNKHRAD 689 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,674,427 Number of Sequences: 237096 Number of extensions: 1110337 Number of successful extensions: 1543 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1543 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4820001670 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -