BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b24 (715 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 77 7e-16 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 77 7e-16 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 77 7e-16 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 77 7e-16 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 48 2e-07 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 30 0.083 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 26 1.0 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 2.4 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 24 4.1 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 24 4.1 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 24 4.1 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 24 4.1 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 24 4.1 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 4.1 AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding pr... 23 7.2 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 7.2 AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding pr... 23 7.2 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 7.2 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 9.5 AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. 23 9.5 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 76.6 bits (180), Expect = 7e-16 Identities = 35/99 (35%), Positives = 56/99 (56%) Frame = +2 Query: 419 HYTIGKEIVDLVLDRVRKLADQCTGLQGFLIXXXXXXXXXXXXXXLLMERLSVDYGKKSK 598 HYT G E+VD VLD VRK + C LQGF + LL+ ++ +Y + Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60 Query: 599 LEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDAAFMVD 715 +++ P+P++S VVEPYN+ L+ H +E++D + +D Sbjct: 61 NTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCID 99 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 76.6 bits (180), Expect = 7e-16 Identities = 35/99 (35%), Positives = 56/99 (56%) Frame = +2 Query: 419 HYTIGKEIVDLVLDRVRKLADQCTGLQGFLIXXXXXXXXXXXXXXLLMERLSVDYGKKSK 598 HYT G E+VD VLD VRK + C LQGF + LL+ ++ +Y + Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60 Query: 599 LEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDAAFMVD 715 +++ P+P++S VVEPYN+ L+ H +E++D + +D Sbjct: 61 NTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCID 99 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 76.6 bits (180), Expect = 7e-16 Identities = 35/99 (35%), Positives = 56/99 (56%) Frame = +2 Query: 419 HYTIGKEIVDLVLDRVRKLADQCTGLQGFLIXXXXXXXXXXXXXXLLMERLSVDYGKKSK 598 HYT G E+VD VLD VRK + C LQGF + LL+ ++ +Y + Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60 Query: 599 LEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDAAFMVD 715 +++ P+P++S VVEPYN+ L+ H +E++D + +D Sbjct: 61 NTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCID 99 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 76.6 bits (180), Expect = 7e-16 Identities = 35/99 (35%), Positives = 56/99 (56%) Frame = +2 Query: 419 HYTIGKEIVDLVLDRVRKLADQCTGLQGFLIXXXXXXXXXXXXXXLLMERLSVDYGKKSK 598 HYT G E+VD VLD VRK + C LQGF + LL+ ++ +Y + Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIM 60 Query: 599 LEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDAAFMVD 715 +++ P+P++S VVEPYN+ L+ H +E++D + +D Sbjct: 61 NTYSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCID 99 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 48.4 bits (110), Expect = 2e-07 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = +2 Query: 101 MRECISIHAGQAGVQIGNACWE 166 MRECIS+H GQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 40.3 bits (90), Expect = 6e-05 Identities = 28/69 (40%), Positives = 37/69 (53%) Frame = +3 Query: 168 CIVSNMASNQTGRCPRTKPSAAETIPSTHSSAKQEPVNMFLEQYS*I*NQQ*WMRYARVH 347 C V +MASN+T RCPRT+ S A ST SS + + S I ++ MR A Sbjct: 23 CTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSIWSRPSSMRCAPAR 82 Query: 348 TANFSTPSN 374 TA+ ST S+ Sbjct: 83 TASCSTRSS 91 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 29.9 bits (64), Expect = 0.083 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 162 GSCIVSNMASNQTGRCPRTKPSAAETIPST 251 G+ I + ++ + CPRT+ + AET PST Sbjct: 63 GASIRMHASARKRAYCPRTRSACAETFPST 92 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 26.2 bits (55), Expect = 1.0 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 505 SDLPFVRWRHRIRFCITPYGTSLRR 579 S+LP V + HR++ CI P S++R Sbjct: 452 SNLPDVSFVHRVQTCIIPAAFSVQR 476 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.0 bits (52), Expect = 2.4 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = +3 Query: 159 VGSCIVSNMASNQTGRCPRTKPSAAETIPSTHS-SAKQEPVNMFLEQY 299 V +V + AS QTGR P +A T +HS +AK +F Q+ Sbjct: 8 VAGMMVKSEAS-QTGRSPSAAGTATTTTSPSHSNAAKMGSRRIFTAQF 54 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/37 (27%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 626 VVPDISRI-QVWISYHNRRRDVP*GVMQNLIRCRHRT 519 ++P++ + Q+ + H R +V G+++N+I C R+ Sbjct: 224 LLPNMEGVSQINLCLHERDFEVGYGILENIISCMDRS 260 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/37 (27%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 626 VVPDISRI-QVWISYHNRRRDVP*GVMQNLIRCRHRT 519 ++P++ + Q+ + H R +V G+++N+I C R+ Sbjct: 224 LLPNMEGVSQINLCLHERDFEVGYGILENIISCMDRS 260 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/37 (27%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 626 VVPDISRI-QVWISYHNRRRDVP*GVMQNLIRCRHRT 519 ++P++ + Q+ + H R +V G+++N+I C R+ Sbjct: 224 LLPNMEGVSQINLCLHERDFEVGYGILENIISCMDRS 260 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/37 (27%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 626 VVPDISRI-QVWISYHNRRRDVP*GVMQNLIRCRHRT 519 ++P++ + Q+ + H R +V G+++N+I C R+ Sbjct: 224 LLPNMEGVSQINLCLHERDFEVGYGILENIISCMDRS 260 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/37 (27%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 626 VVPDISRI-QVWISYHNRRRDVP*GVMQNLIRCRHRT 519 ++P++ + Q+ + H R +V G+++N+I C R+ Sbjct: 224 LLPNMEGVSQINLCLHERDFEVGYGILENIISCMDRS 260 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/37 (27%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -3 Query: 626 VVPDISRI-QVWISYHNRRRDVP*GVMQNLIRCRHRT 519 ++P++ + Q+ + H R +V G+++N+I C R+ Sbjct: 451 LLPNMEGVSQINLCLHERDFEVGYGILENIISCMDRS 487 >AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding protein AgamOBP2 protein. Length = 159 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 349 VCTRAYLIHYCW 314 VC RA+ H CW Sbjct: 135 VCERAFWFHKCW 146 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 7.2 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 208 HLPVWLDAMFETIQLPTR 155 H+PV L AM ET+Q R Sbjct: 817 HIPVHLGAMQETVQYQLR 834 >AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding protein protein. Length = 157 Score = 23.4 bits (48), Expect = 7.2 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 349 VCTRAYLIHYCW 314 VC RA+ H CW Sbjct: 135 VCERAFWFHKCW 146 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 7.2 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = -3 Query: 596 WISYHN--RRRDVP*G---VMQNLIRCRHRTNGRSESPAVRCIDQRV 471 W S N R + VP G ++Q+ R SE P VRC+ V Sbjct: 599 WQSIANALREKGVPSGLLRILQSYFTDRELIFNTSEGPVVRCVSAGV 645 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.0 bits (47), Expect = 9.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 526 WRHRIRFCITPYGTSLRRL 582 W+H +R + P GT+ RL Sbjct: 9 WQHWLRSSVLPCGTTSNRL 27 >AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. Length = 226 Score = 23.0 bits (47), Expect = 9.5 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -2 Query: 231 PPTVLSEGICPSGWMPCSRQY 169 PP + ++G C +GW+ C ++ Sbjct: 102 PPGINADGSCQNGWV-CEHRW 121 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 794,003 Number of Sequences: 2352 Number of extensions: 16119 Number of successful extensions: 50 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -