BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b21 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domai... 27 0.47 AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. 25 3.3 >DQ370040-1|ABD18601.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 27.5 bits (58), Expect = 0.47 Identities = 25/81 (30%), Positives = 37/81 (45%) Frame = +3 Query: 267 SGRATVPPNLLAVHPCALLP*IYFFIDYLNVPINGVNVHDIIGYKFDYGPVARSPRAGRS 446 +GR TV N + V C + I F+ L P + + +D D GP A R + Sbjct: 26 TGRKTVRKNAVFVCDCVVT--IIVFLSRLKGP-DTIVCYDPNEVYDDCGP-ACGDRTCTN 81 Query: 447 EREHGAGDDAGCHRSCGPKLF 509 +R++ D+ C RSC P F Sbjct: 82 QRKN----DSACRRSCNPGCF 98 >AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. Length = 100 Score = 24.6 bits (51), Expect = 3.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 453 EHGAGDDAGCH 485 +HGA DDA CH Sbjct: 7 DHGAPDDANCH 17 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 775,474 Number of Sequences: 2352 Number of extensions: 15224 Number of successful extensions: 22 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -