BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b21 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 29 0.062 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 7.1 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 7.1 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 28.7 bits (61), Expect = 0.062 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 3/80 (3%) Frame = +1 Query: 517 MQLELKCCGVNSNLDWYKHRSSYPPACCGRASNEKRGERCDFP-LYPTGCLRPA--LIQL 687 +Q L+CCGV+S D+ + P +CC N C Y GC+ ++L Sbjct: 139 IQKNLQCCGVHSLSDY--NDKPIPASCC----NSPENNTCSISNSYTNGCVEALKDTVKL 192 Query: 688 RNYVNSLSALASAMIVCMAV 747 V A+A A++ + + Sbjct: 193 AGTVFGSVAIAIAIVELIGI 212 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 475 ASSPAPCSRSERPARGERATG 413 AS+P+ + S PA+G A G Sbjct: 518 ASAPSSSTSSSPPAKGAAAAG 538 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 191 HAADPPKMAPPLNKSPAHANKTKPLL 114 + A PP +A PLN +P + LL Sbjct: 210 YTACPPTLACPLNPNPQPLTGQQELL 235 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,922 Number of Sequences: 438 Number of extensions: 4390 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -