BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b20 (617 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.78 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.78 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.0 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 24 1.0 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 24 1.0 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 3.2 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 5.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 5.5 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 9.6 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.6 bits (51), Expect = 0.78 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -1 Query: 416 RSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRTCPLK 306 ++CP + A+ G P GP ++L G L+ Sbjct: 262 QACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVLALE 298 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 24.6 bits (51), Expect = 0.78 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -1 Query: 416 RSCPVGRFAQTARNGRSPWFQAQGPPSQLAGRTCPLK 306 ++CP + A+ G P GP ++L G L+ Sbjct: 262 QACPTPEYRWYAQTGSEPMLVLSGPRTRLLGSVLALE 298 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 24.2 bits (50), Expect = 1.0 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 482 VDSVLDVVRKEAEGCDCLQG 541 +DS+++++R + CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 24.2 bits (50), Expect = 1.0 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 355 RLKVHHHSSRDVLAP*SFVIVDIDAFKLQVGVAAVSTRGVNAVLV 221 ++++ H RD++ +++ K VG V T+G NAV V Sbjct: 108 QIRMKHGLIRDLIVDRDVPTWEVNILKSIVGQLQVDTQGENAVKV 152 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 24.2 bits (50), Expect = 1.0 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 391 PKRPGTDGVHGSRLKVHH 338 P+ PGT ++ ++LK HH Sbjct: 139 PREPGTPRINFTKLKRHH 156 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 24.2 bits (50), Expect = 1.0 Identities = 12/50 (24%), Positives = 21/50 (42%) Frame = -2 Query: 496 QYRINQFSPLCVMSFRPVIPRPRLSEDEVVRSEDLPKRPGTDGVHGSRLK 347 Q+ SP+ S+ P P ++ DE+ + L +DG + K Sbjct: 127 QHNNGYASPMSTSSYDPYSPNSKIGRDELSQPGSLNGYGSSDGCDARKKK 176 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +3 Query: 222 TSTALTPRVLTAATPTCSLNASMST 296 T+T T T TP + NAS +T Sbjct: 664 TTTTTTTTTTTTTTPNTTQNASATT 688 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 69 FFLHDQILESVYL 107 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 5.5 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 69 FFLHDQILESVYL 107 FFLH Q+L YL Sbjct: 259 FFLHKQVLNRYYL 271 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.0 bits (42), Expect = 9.6 Identities = 11/42 (26%), Positives = 19/42 (45%) Frame = -1 Query: 488 NQPVQPPLCNVLSPSYSPPQTVRRRSCPVGRFAQTARNGRSP 363 ++PV+PP P + P+ + +S P + N SP Sbjct: 335 SEPVEPPRRKNNCPLHCKPELGQSQSSPKFVARREESNSSSP 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,054 Number of Sequences: 438 Number of extensions: 4194 Number of successful extensions: 11 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -