BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b16 (400 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 4.5 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 4.5 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 21 4.5 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.0 bits (42), Expect = 4.5 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +2 Query: 242 YVATLVFSIFFGTGFWAPFIILWY 313 + +VF +FF G +P L Y Sbjct: 136 FAGLIVFILFFAQGLTSPIFNLVY 159 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.0 bits (42), Expect = 4.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 98 LRALFANAFRGKSYVGKAQESLRLQNRHHHDEGPP 202 + + +A +G + +G Q+ Q HHH PP Sbjct: 25 MHSWYAGYHQG-AQMGPEQQMWEPQMWHHHSHMPP 58 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.0 bits (42), Expect = 4.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +2 Query: 98 LRALFANAFRGKSYVGKAQESLRLQNRHHHDEGPP 202 + + +A +G + +G Q+ Q HHH PP Sbjct: 25 MHSWYAGYHQG-AQMGPEQQMWEPQMWHHHSHMPP 58 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,273 Number of Sequences: 336 Number of extensions: 1838 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8541369 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -