BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b15 (430 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.011 SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09) 35 0.025 SB_1610| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.23 SB_45406| Best HMM Match : 7tm_2 (HMM E-Value=5.9) 31 0.41 SB_39819| Best HMM Match : Extensin_2 (HMM E-Value=1) 31 0.41 SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) 31 0.54 SB_40674| Best HMM Match : Extensin_2 (HMM E-Value=0.19) 29 1.2 SB_1612| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_17109| Best HMM Match : LRR_1 (HMM E-Value=2.9e-10) 28 2.9 SB_13882| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.2e-13) 27 5.0 SB_15408| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_10635| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_5346| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 >SB_59202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1530 Score = 36.3 bits (80), Expect = 0.011 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 234 CVDGCYCDKGLVRSYSKGPCIEAGKCRDKKIEKILD 341 CV GCYC GL+ + G C+++ +C+ K K D Sbjct: 1248 CVSGCYCPDGLI-MHDNGTCVQSMQCQCKHNNKYYD 1282 Score = 35.1 bits (77), Expect = 0.025 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 234 CVDGCYCDKGLVRSYSKGPCIEAGKC 311 CVDGC+C +G ++ +G C++ G+C Sbjct: 787 CVDGCFCPEGKIQ--DRGKCVDPGQC 810 Score = 29.1 bits (62), Expect = 1.6 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 228 KHCVDGCYCDKGLVRSYSKGPCIEAGKC 311 + CV+GCYC+K ++ C++ +C Sbjct: 1154 RRCVEGCYCEKEGELMNNEHKCVDKTQC 1181 >SB_55591| Best HMM Match : TIL (HMM E-Value=4.2e-09) Length = 133 Score = 35.1 bits (77), Expect = 0.025 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 234 CVDGCYCDKGLVRSYSKGPCIEAGKC 311 CVDGC+C +G ++ +G C++ G+C Sbjct: 88 CVDGCFCPEGKIQ--DRGKCVDPGQC 111 >SB_1610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 519 Score = 31.9 bits (69), Expect = 0.23 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +3 Query: 153 QFYEEYTCWTSSSKMERTRTLSKKFKHCVDGCY 251 QFY E CW SS E+T + K CVD CY Sbjct: 352 QFYGE--CW-SSKDAEKTYAMDGKSSRCVDKCY 381 >SB_45406| Best HMM Match : 7tm_2 (HMM E-Value=5.9) Length = 225 Score = 31.1 bits (67), Expect = 0.41 Identities = 17/37 (45%), Positives = 20/37 (54%) Frame = -2 Query: 165 LHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFPT 55 L R A TL LCR+ R P L+ + RR KR PT Sbjct: 154 LRRHKRAPTLSLCRLRRHKRAPTLSLRRLRRHKRSPT 190 >SB_39819| Best HMM Match : Extensin_2 (HMM E-Value=1) Length = 259 Score = 31.1 bits (67), Expect = 0.41 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +RFP Sbjct: 221 CTNYRKRRCPPLTWCTYYRKRRCPPLTKCTNYRKRRFP 258 Score = 27.9 bits (59), Expect = 3.8 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = -2 Query: 183 RSNTCTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 R CT +R L C Y RCP LT R +R P Sbjct: 21 RLTKCTNYRKRRCPPLTKCTNYRKRRCPPLTRCTNYRKRRCP 62 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C YL RCP LT +R P Sbjct: 123 CTNYRKRRCPPLTRCTYYLKRRCPPLTKCTNYLKRRCP 160 Score = 27.5 bits (58), Expect = 5.0 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT + L C YL RCP LT R +R P Sbjct: 137 CTYYLKRRCPPLTKCTNYLKRRCPPLTKCTNYRKRRCP 174 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 11 CTNYRKRRCPRLTKCTNYRKRRCPPLTKCTNYRKRRCP 48 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 39 CTNYRKRRCPPLTRCTNYRKRRCPPLTRCTNYRKRRCP 76 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 53 CTNYRKRRCPPLTRCTNYRKRRCPPLTKCTNYRKRRCP 90 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 67 CTNYRKRRCPPLTKCTNYRKRRCPPLTWCTNYRKRRCP 104 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 81 CTNYRKRRCPPLTWCTNYRKRRCPPLTRCTNYRKRRCP 118 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 95 CTNYRKRRCPPLTRCTNYRKRRCPPLTMCTNYRKRRCP 132 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 165 CTNYRKRRCPPLTRCTNYRKRRCPPLTKCTNYRKRRCP 202 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 179 CTNYRKRRCPPLTKCTNYRKRRCPPLTKCTNYRKRRCP 216 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 193 CTNYRKRRCPPLTKCTNYRKRRCPPLTRCTNYRKRRCP 230 >SB_58268| Best HMM Match : Extensin_2 (HMM E-Value=0.002) Length = 458 Score = 30.7 bits (66), Expect = 0.54 Identities = 15/38 (39%), Positives = 17/38 (44%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT + L C YL RCP LT R KR+P Sbjct: 266 CTYYLKRRCPPLTKCTNYLKRRCPPLTKRTNYRKKRYP 303 Score = 29.9 bits (64), Expect = 0.94 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -2 Query: 177 NTCTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 N CT +R L C Y RCP LT R +R P Sbjct: 110 NKCTYYRKRRCPPLTRCTNYRKRRCPPLTKCTNYRKRRCP 149 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 98 CTNYRKRRCPPLNKCTYYRKRRCPPLTRCTNYRKRRCP 135 Score = 27.9 bits (59), Expect = 3.8 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 210 CTNYRKRRCPPLTKCTYYRKRRCPPLTKCTNYRKRRCP 247 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 70 CTNYRKRRCPPLTWCTNYRKRRCPPLTRCTNYRKRRCP 107 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 126 CTNYRKRRCPPLTKCTNYRKRRCPPLTKCTNYRKRRCP 163 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 140 CTNYRKRRCPPLTKCTNYRKRRCPPLTKCTNYRKRRCP 177 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 154 CTNYRKRRCPPLTKCTNYRKRRCPPLTKCTNYRKRRCP 191 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 168 CTNYRKRRCPPLTKCTNYRKRRCPPLTKCTNYRKRRCP 205 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C Y RCP LT R +R P Sbjct: 182 CTNYRKRRCPPLTKCTNYRKRRCPPLTRCTNYRKRRCP 219 >SB_40674| Best HMM Match : Extensin_2 (HMM E-Value=0.19) Length = 291 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = -2 Query: 177 NTCTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 N CT +R L C Y RCP LT R +R P Sbjct: 172 NKCTYYRKRRCPPLTRCTNYRKRRCPPLTKCNYYRKRRCP 211 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT +R L C YL RCP LT +R P Sbjct: 230 CTNYRKRRCPPLTRCTNYLKRRCPPLTKCTNYLKRRCP 267 Score = 26.6 bits (56), Expect = 8.7 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -2 Query: 171 CTLHRTDTACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 CT + L C YL RCP LT R +R P Sbjct: 244 CTNYLKRRCPPLTKCTNYLKRRCPPLTKCTNYRKRRCP 281 >SB_1612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 29.1 bits (62), Expect = 1.6 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 153 QFYEEYTCWTSSSKMERTRTLSKKFKHCVDGCY 251 QFY E CW S E+T + K +C D CY Sbjct: 167 QFYGE--CW-SGKDAEKTYAMDGKSSNCADKCY 196 >SB_17109| Best HMM Match : LRR_1 (HMM E-Value=2.9e-10) Length = 390 Score = 28.3 bits (60), Expect = 2.9 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +1 Query: 331 KSLTIYRFIRKELNKFTSLYIHMPRLCFYIKK 426 KS T RF+ E N FT+ H+PRLC +KK Sbjct: 323 KSATSLRFLLIEDNIFTAE--HVPRLCRMLKK 352 >SB_13882| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.2e-13) Length = 340 Score = 27.5 bits (58), Expect = 5.0 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = +3 Query: 96 IEGTALINKCGTNEVYKPCQFYEEYTCWTSSSKMERTRTLSKKFKHCVDGCYCDKGLVRS 275 ++G ++C + Y+P Y + T W K + R + FK+C C G+ R+ Sbjct: 92 LQGATSKDQCRECKDYEPEDKYGDCTTWRQQMKCVKDRPM--MFKYCPKTC----GICRT 145 Query: 276 YSK 284 + K Sbjct: 146 WQK 148 >SB_15408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 27.1 bits (57), Expect = 6.6 Identities = 19/84 (22%), Positives = 33/84 (39%), Gaps = 6/84 (7%) Frame = +3 Query: 99 EGTALINKCGTNEVYKPCQFYEEYTCWTSSSKMERTRTLSKKFK-HCVDG-----CYCDK 260 +G + +CG VY Y+ C S ++ S C++ C C + Sbjct: 337 DGKRCVGRCG--RVYGVVCIYKRTLCCVDISDVDECTDESVCTNGQCINNIGSFTCTCRR 394 Query: 261 GLVRSYSKGPCIEAGKCRDKKIEK 332 G S + C + +CR+K + K Sbjct: 395 GFTLSLDRTRCDDMDECREKDVCK 418 >SB_10635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 150 TACTLRLCRIYLSMRCPQLT*MQTRRTKRFP 58 T L C Y RCP LT R +RFP Sbjct: 65 TMSPLTWCTYYRKRRCPPLTKGNYYRKRRFP 95 >SB_5346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/40 (32%), Positives = 19/40 (47%) Frame = +3 Query: 39 CKMKVLWGIVLFSSFASKLIEGTALINKCGTNEVYKPCQF 158 C M ++G V FS+ + G A ++ CG VY F Sbjct: 362 CGMMSVYGDVHFSTCGMMSVYGNAHLSTCGMMSVYGNAHF 401 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,824,524 Number of Sequences: 59808 Number of extensions: 241491 Number of successful extensions: 800 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -