BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b14 (614 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 3.6 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 3.6 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 3.6 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 3.6 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 3.6 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 3.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 3.6 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 22 3.6 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 3.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 6.2 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 6.2 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 21 6.2 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 126 TPPLSTPSNSNATKSSGLTSPL 147 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 126 TPPLSTPSNSNATKSSGLTSPL 147 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 126 TPPLSTPSNSNATKSSGLTSPL 147 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 126 TPPLSTPSNSNATKSSGLTSPL 147 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 126 TPPLSTPSNSNATKSSGLTSPL 147 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 82 TPPLSTPSNSNATKSSGLTSPL 103 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 126 TPPLSTPSNSNATKSSGLTSPL 147 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 126 TPPLSTPSNSNATKSSGLTSPL 147 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -2 Query: 325 TSPLAPYLRSRASKSDGMTAAL 260 T PL+ S A+KS G+T+ L Sbjct: 126 TPPLSTPSNSNATKSSGLTSPL 147 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/20 (35%), Positives = 14/20 (70%) Frame = +2 Query: 170 SENFIRLQSEQFKY*IYVQK 229 +ENF++ Q E+F+ +Y + Sbjct: 339 NENFLQCQDEKFESFVYYHR 358 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 6.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 468 DVVELDLANNKLTEWQEVFAILEQTPRVRFLNLSFNRLSA 587 +++ L LA N L + +R+LNL +N LSA Sbjct: 467 NLLSLSLAFNSLPT--VALEVAGNISSLRYLNLDYNDLSA 504 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.4 bits (43), Expect = 6.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -2 Query: 328 FTSPLAPYLRSRASKSDGMTAALIKNHWKQRVFFLN 221 +T P Y + ++ + + IKN W FF+N Sbjct: 96 WTDPRLAYGKRPGVETLSVGSEFIKNIWVPDTFFVN 131 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,278 Number of Sequences: 336 Number of extensions: 2566 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -