BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b13 (562 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 3.0 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 3.9 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 24 3.9 AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcrip... 23 6.8 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 9.0 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.2 bits (50), Expect = 3.0 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = +3 Query: 306 CHVEQDPYCPKSITIVKETVSQEVHKHENCESDKEV 413 CH + + YCP+ T+ Q V E + + V Sbjct: 64 CHGQIEKYCPEEYTVDPSNTFQLVQGRELTKPSRRV 99 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.8 bits (49), Expect = 3.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 168 EDCDTTSIYKAVEKGTQTSSTGLS 239 E+CD +I A E GT GLS Sbjct: 141 EECDRLNISYAFENGTALEIPGLS 164 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.8 bits (49), Expect = 3.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +3 Query: 168 EDCDTTSIYKAVEKGTQTSSTGLS 239 E+CD +I A E GT GLS Sbjct: 142 EECDRLNISYAFENGTALEIPGLS 165 >AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcription factor protein. Length = 185 Score = 23.0 bits (47), Expect = 6.8 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 369 QEVHKHENCESDKEVSAHRYVYKKEVIE 452 Q +H+ E +KE +RY+ ++ IE Sbjct: 11 QSYSRHQTIELEKEFHFNRYLNRRRRIE 38 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 22.6 bits (46), Expect = 9.0 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 161 QILGRHRQGTRSGII*HVLQCSC 93 QI+ RH +G +I + CSC Sbjct: 65 QIISRHGEGYVIAVINKITFCSC 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 525,715 Number of Sequences: 2352 Number of extensions: 9754 Number of successful extensions: 106 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52563375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -