BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b09 (676 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 26 0.25 AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. 24 0.99 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 1.7 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 1.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 7.0 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 26.2 bits (55), Expect = 0.25 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 344 VKNVLLAPALVISTHQLQACT 406 +K LLA AL+ISTHQ +A T Sbjct: 3 LKLCLLASALLISTHQTEAKT 23 >AY453651-1|AAR89057.1| 199|Tribolium castaneum serrate protein. Length = 199 Score = 24.2 bits (50), Expect = 0.99 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 388 STPSMYDCRKYGHCLPSNDLITRFECLPNF 477 S PS+ C ++GHC+ + R +C P F Sbjct: 33 SAPSI--CGEHGHCVNLPGVGHRCQCQPGF 60 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 602 ILGPAGNLALKREENLENHXPHHLE 676 +LGP G+ L + +H HH++ Sbjct: 148 VLGPTGSPPLTTQSMNNHHMGHHMQ 172 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.4 bits (48), Expect = 1.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 602 ILGPAGNLALKREENLENHXPHHLE 676 +LGP G+ L + +H HH++ Sbjct: 150 VLGPTGSPPLTTQSMNNHHMGHHMQ 174 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 7.0 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +1 Query: 430 LPSNDLITRFECLPN 474 L DL RFECL N Sbjct: 32 LDDRDLWLRFECLTN 46 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,095 Number of Sequences: 336 Number of extensions: 3188 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -