BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b07 (607 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0BZ33 Cluster: Chromosome undetermined scaffold_138, w... 37 0.32 UniRef50_Q9PQ71 Cluster: Probable thiamine biosynthesis protein ... 33 5.2 UniRef50_Q183R9 Cluster: Cation-transporting ATPase; n=8; Clostr... 33 6.9 >UniRef50_A0BZ33 Cluster: Chromosome undetermined scaffold_138, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_138, whole genome shotgun sequence - Paramecium tetraurelia Length = 1412 Score = 37.1 bits (82), Expect = 0.32 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = -1 Query: 565 LCIRMYCINSNV*TRNRGSSFKLYASAQEFHNGHCLFVCM 446 LC++ YC+ S N S L A+E HNGH L+VC+ Sbjct: 1296 LCLKTYCLGSC----NNNQSGNLSLHAEEEHNGHSLYVCL 1331 >UniRef50_Q9PQ71 Cluster: Probable thiamine biosynthesis protein thiI; n=1; Ureaplasma parvum|Rep: Probable thiamine biosynthesis protein thiI - Ureaplasma parvum (Ureaplasma urealyticum biotype 1) Length = 390 Score = 33.1 bits (72), Expect = 5.2 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = -1 Query: 316 QNITPCIGQDNLNCINIISYNYVRI 242 QN+T C+G DNL IN+ +YN +I Sbjct: 38 QNLTYCVGYDNLKIINLENYNLKQI 62 >UniRef50_Q183R9 Cluster: Cation-transporting ATPase; n=8; Clostridium|Rep: Cation-transporting ATPase - Clostridium difficile (strain 630) Length = 924 Score = 32.7 bits (71), Expect = 6.9 Identities = 14/42 (33%), Positives = 29/42 (69%) Frame = -1 Query: 454 VCMFIIIPTRRRYIH*L*YNNIVSLFQTLKPRQRAYVLTLTL 329 +CMF+II +R+ + L ++++S Q+L+P + AY++ + L Sbjct: 268 LCMFMIIQMQRKGMLILDTSSVLSFLQSLEPAKNAYMVCIAL 309 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 564,402,556 Number of Sequences: 1657284 Number of extensions: 10620081 Number of successful extensions: 20829 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20235 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20825 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43147568152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -