BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10b07 (607 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 27 0.62 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 3.3 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 26.6 bits (56), Expect = 0.62 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 489 EAYSLKLDPRLRVQTFELMQYIRIQSPLNKRS 584 E Y+ R +V E MQY+ ++ P+N ++ Sbjct: 115 ETYNKHFSQREKVAKIETMQYLPVEGPVNLKT 146 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 489 EAYSLKLDPRLRVQTFELMQYIRIQSPLN 575 EAYS +L R R Q++RI+ N Sbjct: 382 EAYSSRLQSRFRSDPASFWQFVRIRRGCN 410 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 629,451 Number of Sequences: 2352 Number of extensions: 11175 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 58870980 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -